Lineage for d1re5b_ (1re5 B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2010255Fold a.127: L-aspartase-like [48556] (1 superfamily)
    multihelical, consists of three all-alpha domains
  4. 2010256Superfamily a.127.1: L-aspartase-like [48557] (3 families) (S)
  5. 2010257Family a.127.1.1: L-aspartase/fumarase [48558] (6 protein domains)
  6. 2010258Protein 3-carboxy-cis,cis-muconate cycloisomerase (CMLE) [101444] (2 species)
  7. 2010261Species Pseudomonas putida, strain KT2440 [TaxId:303] [110023] (1 PDB entry)
    Uniprot Q88N37
  8. 2010263Domain d1re5b_: 1re5 B: [104912]
    complexed with cit, dtt

Details for d1re5b_

PDB Entry: 1re5 (more details), 2.6 Å

PDB Description: Crystal structure of 3-carboxy-cis,cis-muconate lactonizing enzyme from Pseudomonas putida
PDB Compounds: (B:) 3-carboxy-cis,cis-muconate cycloisomerase

SCOPe Domain Sequences for d1re5b_:

Sequence, based on SEQRES records: (download)

>d1re5b_ a.127.1.1 (B:) 3-carboxy-cis,cis-muconate cycloisomerase (CMLE) {Pseudomonas putida, strain KT2440 [TaxId: 303]}
nqlfdayftapamreifsdrgrlqgmldfeaalaraeasaglvphsavaaieaacqaery
dtgalanaiatagnsaiplvkalgkviatgvpeaeryvhlgatsqdamdtglvlqlrdal
dlieadlgkladtlsqqalkhadtplvgrtwlqhatpvtlgmklagvlgaltrhrqrlqe
lrprllvlqfggasgslaalgskampvaealaeqlkltlpeqpwhtqrdrlvefasvlgl
vagslgkfgrdisllmqteagevfepsapgkggsstmphkrnpvgaavligaatrvpgll
stlfaampqeherslglwhaewetlpdicclvsgalrqaqviaegmevdaarmrrnldlt
qglvlaeavsivlaqrlgrdrahhlleqccqravaeqrhlravlgdepqvsaelsgeeld
rlldpahylgqarvwvaravsehqrfta

Sequence, based on observed residues (ATOM records): (download)

>d1re5b_ a.127.1.1 (B:) 3-carboxy-cis,cis-muconate cycloisomerase (CMLE) {Pseudomonas putida, strain KT2440 [TaxId: 303]}
nqlfdayftapamreifsdrgrlqgmldfeaalaraeasaglvphsavaaieaacqaery
dtgalanaiatagnsaiplvkalgkviatgvpeaeryvhlgatsqdamdtglvlqlrdal
dlieadlgkladtlsqqalkhadtplvgrtwlqhatpvtlgmklagvlgaltrhrqrlqe
lrprllvlqfggasgslaalgskampvaealaeqlkltlpeqpwhtqrdrlvefasvlgl
vagslgkfgrdisllmqteagevfepsapmphkrnpvgaavligaatrvpgllstlfaam
pqeherslglwhaewetlpdicclvsgalrqaqviaegmevdaarmrrnldltqglvlae
avsivlaqrlgrdrahhlleqccqravaeqrhlravlgdepqvsaelsgeeldrlldpah
ylgqarvwvaravsehqrfta

SCOPe Domain Coordinates for d1re5b_:

Click to download the PDB-style file with coordinates for d1re5b_.
(The format of our PDB-style files is described here.)

Timeline for d1re5b_: