Lineage for d1re5a_ (1re5 A:)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.127: L-aspartase-like [48556] (1 superfamily)
    multihelical, consists of three all-alpha domains
  4. Superfamily a.127.1: L-aspartase-like [48557] (3 families) (S)
  5. Family a.127.1.1: L-aspartase/fumarase [48558] (6 proteins)
  6. Protein 3-carboxy-cis,cis-muconate cycloisomerase (CMLE) [101444] (2 species)
  7. Species Pseudomonas putida, strain KT2440 [TaxId:303] [110023] (1 PDB entry)
    Uniprot Q88N37
  8. Domain d1re5a_: 1re5 A: [104911]
    complexed with cit, dtt

Details for d1re5a_

PDB Entry: 1re5 (more details), 2.6 Å

PDB Description: Crystal structure of 3-carboxy-cis,cis-muconate lactonizing enzyme from Pseudomonas putida
PDB Compounds: (A:) 3-carboxy-cis,cis-muconate cycloisomerase

SCOPe Domain Sequences for d1re5a_:

Sequence, based on SEQRES records: (download)

>d1re5a_ a.127.1.1 (A:) 3-carboxy-cis,cis-muconate cycloisomerase (CMLE) {Pseudomonas putida, strain KT2440 [TaxId: 303]}
nqlfdayftapamreifsdrgrlqgmldfeaalaraeasaglvphsavaaieaacqaery
dtgalanaiatagnsaiplvkalgkviatgvpeaeryvhlgatsqdamdtglvlqlrdal
dlieadlgkladtlsqqalkhadtplvgrtwlqhatpvtlgmklagvlgaltrhrqrlqe
lrprllvlqfggasgslaalgskampvaealaeqlkltlpeqpwhtqrdrlvefasvlgl
vagslgkfgrdisllmqteagevfepsapgkggsstmphkrnpvgaavligaatrvpgll
stlfaampqeherslglwhaewetlpdicclvsgalrqaqviaegmevdaarmrrnldlt
qglvlaeavsivlaqrlgrdrahhlleqccqravaeqrhlravlgdepqvsaelsgeeld
rlldpahylgqarvwvaravsehqrfta

Sequence, based on observed residues (ATOM records): (download)

>d1re5a_ a.127.1.1 (A:) 3-carboxy-cis,cis-muconate cycloisomerase (CMLE) {Pseudomonas putida, strain KT2440 [TaxId: 303]}
nqlfdayftapamreifsdrgrlqgmldfeaalaraeasaglvphsavaaieaacqaery
dtgalanaiatagnsaiplvkalgkviatgvpeaeryvhlgatsqdamdtglvlqlrdal
dlieadlgkladtlsqqalkhadtplvgrtwlqhatpvtlgmklagvlgaltrhrqrlqe
lrprllvlqfggasgslaalgskampvaealaeqlkltlpeqpwhtqrdrlvefasvlgl
vagslgkfgrdisllmqteagevfepsapkrnpvgaavligaatrvpgllstlfaampqe
herslglwhaewetlpdicclvsgalrqaqviaegmevdaarmrrnldltqglvlaeavs
ivlaqrlgrdrahhlleqccqravaeqrhlravlgdepqvsaelsgeeldrlldpahylg
qarvwvaravsehqrfta

SCOPe Domain Coordinates for d1re5a_ are not available.

Timeline for d1re5a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1re5b_, d1re5c_, d1re5d_