PDB entry 1re5

View 1re5 on RCSB PDB site
Description: Crystal structure of 3-carboxy-cis,cis-muconate lactonizing enzyme from Pseudomonas putida
Class: isomerase
Keywords: Homotetramer, fumarase class II cycloisomerase, Molecular evolution, ISOMERASE
Deposited on 2003-11-06, released 2004-06-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.212
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-carboxy-cis,cis-muconate cycloisomerase
    Species: Pseudomonas putida [TaxId:160488]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q88N37 (Start-449)
      • conflict (63)
    Domains in SCOPe 2.07: d1re5a_
  • Chain 'B':
    Compound: 3-carboxy-cis,cis-muconate cycloisomerase
    Species: Pseudomonas putida [TaxId:160488]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q88N37 (Start-449)
      • conflict (63)
    Domains in SCOPe 2.07: d1re5b_
  • Chain 'C':
    Compound: 3-carboxy-cis,cis-muconate cycloisomerase
    Species: Pseudomonas putida [TaxId:160488]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q88N37 (Start-449)
      • conflict (63)
    Domains in SCOPe 2.07: d1re5c_
  • Chain 'D':
    Compound: 3-carboxy-cis,cis-muconate cycloisomerase
    Species: Pseudomonas putida [TaxId:160488]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q88N37 (Start-449)
      • conflict (63)
    Domains in SCOPe 2.07: d1re5d_
  • Heterogens: DTT, CIT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1re5A (A:)
    msnqlfdayftapamreifsdrgrlqgmldfeaalaraeasaglvphsavaaieaacqae
    rydtgalanaiatagnsaiplvkalgkviatgvpeaeryvhlgatsqdamdtglvlqlrd
    aldlieadlgkladtlsqqalkhadtplvgrtwlqhatpvtlgmklagvlgaltrhrqrl
    qelrprllvlqfggasgslaalgskampvaealaeqlkltlpeqpwhtqrdrlvefasvl
    glvagslgkfgrdisllmqteagevfepsapgkggsstmphkrnpvgaavligaatrvpg
    llstlfaampqeherslglwhaewetlpdicclvsgalrqaqviaegmevdaarmrrnld
    ltqglvlaeavsivlaqrlgrdrahhlleqccqravaeqrhlravlgdepqvsaelsgee
    ldrlldpahylgqarvwvaravsehqrfta
    

    Sequence, based on observed residues (ATOM records): (download)
    >1re5A (A:)
    nqlfdayftapamreifsdrgrlqgmldfeaalaraeasaglvphsavaaieaacqaery
    dtgalanaiatagnsaiplvkalgkviatgvpeaeryvhlgatsqdamdtglvlqlrdal
    dlieadlgkladtlsqqalkhadtplvgrtwlqhatpvtlgmklagvlgaltrhrqrlqe
    lrprllvlqfggasgslaalgskampvaealaeqlkltlpeqpwhtqrdrlvefasvlgl
    vagslgkfgrdisllmqteagevfepsapkrnpvgaavligaatrvpgllstlfaampqe
    herslglwhaewetlpdicclvsgalrqaqviaegmevdaarmrrnldltqglvlaeavs
    ivlaqrlgrdrahhlleqccqravaeqrhlravlgdepqvsaelsgeeldrlldpahylg
    qarvwvaravsehqrfta
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1re5B (B:)
    msnqlfdayftapamreifsdrgrlqgmldfeaalaraeasaglvphsavaaieaacqae
    rydtgalanaiatagnsaiplvkalgkviatgvpeaeryvhlgatsqdamdtglvlqlrd
    aldlieadlgkladtlsqqalkhadtplvgrtwlqhatpvtlgmklagvlgaltrhrqrl
    qelrprllvlqfggasgslaalgskampvaealaeqlkltlpeqpwhtqrdrlvefasvl
    glvagslgkfgrdisllmqteagevfepsapgkggsstmphkrnpvgaavligaatrvpg
    llstlfaampqeherslglwhaewetlpdicclvsgalrqaqviaegmevdaarmrrnld
    ltqglvlaeavsivlaqrlgrdrahhlleqccqravaeqrhlravlgdepqvsaelsgee
    ldrlldpahylgqarvwvaravsehqrfta
    

    Sequence, based on observed residues (ATOM records): (download)
    >1re5B (B:)
    nqlfdayftapamreifsdrgrlqgmldfeaalaraeasaglvphsavaaieaacqaery
    dtgalanaiatagnsaiplvkalgkviatgvpeaeryvhlgatsqdamdtglvlqlrdal
    dlieadlgkladtlsqqalkhadtplvgrtwlqhatpvtlgmklagvlgaltrhrqrlqe
    lrprllvlqfggasgslaalgskampvaealaeqlkltlpeqpwhtqrdrlvefasvlgl
    vagslgkfgrdisllmqteagevfepsapmphkrnpvgaavligaatrvpgllstlfaam
    pqeherslglwhaewetlpdicclvsgalrqaqviaegmevdaarmrrnldltqglvlae
    avsivlaqrlgrdrahhlleqccqravaeqrhlravlgdepqvsaelsgeeldrlldpah
    ylgqarvwvaravsehqrfta
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1re5C (C:)
    msnqlfdayftapamreifsdrgrlqgmldfeaalaraeasaglvphsavaaieaacqae
    rydtgalanaiatagnsaiplvkalgkviatgvpeaeryvhlgatsqdamdtglvlqlrd
    aldlieadlgkladtlsqqalkhadtplvgrtwlqhatpvtlgmklagvlgaltrhrqrl
    qelrprllvlqfggasgslaalgskampvaealaeqlkltlpeqpwhtqrdrlvefasvl
    glvagslgkfgrdisllmqteagevfepsapgkggsstmphkrnpvgaavligaatrvpg
    llstlfaampqeherslglwhaewetlpdicclvsgalrqaqviaegmevdaarmrrnld
    ltqglvlaeavsivlaqrlgrdrahhlleqccqravaeqrhlravlgdepqvsaelsgee
    ldrlldpahylgqarvwvaravsehqrfta
    

    Sequence, based on observed residues (ATOM records): (download)
    >1re5C (C:)
    nqlfdayftapamreifsdrgrlqgmldfeaalaraeasaglvphsavaaieaacqaery
    dtgalanaiatagnsaiplvkalgkviatgvpeaeryvhlgatsqdamdtglvlqlrdal
    dlieadlgkladtlsqqalkhadtplvgrtwlqhatpvtlgmklagvlgaltrhrqrlqe
    lrprllvlqfggasgslaalgskampvaealaeqlkltlpeqpwhtqrdrlvefasvlgl
    vagslgkfgrdisllmqteagevfepstmphkrnpvgaavligaatrvpgllstlfaamp
    qeherslglwhaewetlpdicclvsgalrqaqviaegmevdaarmrrnldltqglvlaea
    vsivlaqrlgrdrahhlleqccqravaeqrhlravlgdepqvsaelsgeeldrlldpahy
    lgqarvwvaravsehqrfta
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1re5D (D:)
    msnqlfdayftapamreifsdrgrlqgmldfeaalaraeasaglvphsavaaieaacqae
    rydtgalanaiatagnsaiplvkalgkviatgvpeaeryvhlgatsqdamdtglvlqlrd
    aldlieadlgkladtlsqqalkhadtplvgrtwlqhatpvtlgmklagvlgaltrhrqrl
    qelrprllvlqfggasgslaalgskampvaealaeqlkltlpeqpwhtqrdrlvefasvl
    glvagslgkfgrdisllmqteagevfepsapgkggsstmphkrnpvgaavligaatrvpg
    llstlfaampqeherslglwhaewetlpdicclvsgalrqaqviaegmevdaarmrrnld
    ltqglvlaeavsivlaqrlgrdrahhlleqccqravaeqrhlravlgdepqvsaelsgee
    ldrlldpahylgqarvwvaravsehqrfta
    

    Sequence, based on observed residues (ATOM records): (download)
    >1re5D (D:)
    nqlfdayftapamreifsdrgrlqgmldfeaalaraeasaglvphsavaaieaacqaery
    dtgalanaiatagnsaiplvkalgkviatgvpeaeryvhlgatsqdamdtglvlqlrdal
    dlieadlgkladtlsqqalkhadtplvgrtwlqhatpvtlgmklagvlgaltrhrqrlqe
    lrprllvlqfggasgslaalgskampvaealaeqlkltlpeqpwhtqrdrlvefasvlgl
    vagslgkfgrdisllmqteagevfepsapgkggsstmphkrnpvgaavligaatrvpgll
    stlfaampqeherslglwhaewetlpdicclvsgalrqaqviaegmevdaarmrrnldlt
    qglvlaeavsivlaqrlgrdrahhlleqccqravaeqrhlravlgdepqvsaelsgeeld
    rlldpahylgqarvwvaravsehqrfta