Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (14 families) |
Family c.1.8.3: beta-glycanases [51487] (24 proteins) consist of a number of sequence families |
Protein Xylanase [51488] (6 species) |
Species Bacillus stearothermophilus, Xt6 [TaxId:1422] [69386] (4 PDB entries) |
Domain d1r87a_: 1r87 A: [104840] complexed with cl, so4, xys, zn |
PDB Entry: 1r87 (more details), 1.67 Å
SCOP Domain Sequences for d1r87a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1r87a_ c.1.8.3 (A:) Xylanase {Bacillus stearothermophilus, Xt6 [TaxId: 1422]} kphisalnapqldqrykneftigaavepyqlqnekdvqmlkrhfnsivaenvmkpisiqp eegkfnfeqadrivkfakangmdirfhtlvwhsqvpqwffldkegkpmvnetdpvkreqn kqlllkrlethiktiverykddikywdvvnevvgddgklrnspwyqiagidyikvafqaa rkyggdniklymndyntevepkrtalynlvkqlkeegvpidgighqshiqigwpseaeie ktinmfaalgldnqiteldvsmygwpprayptydaipkqkfldqaarydrlfklyeklsd kisnvtfwgiadnhtwldsradvyydangnvvvdpnapyakvekgkgkdapfvfgpdykv kpaywaiidhk
Timeline for d1r87a_: