Lineage for d1r87a_ (1r87 A:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 473233Fold c.1: TIM beta/alpha-barrel [51350] (31 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 474052Superfamily c.1.8: (Trans)glycosidases [51445] (11 families) (S)
  5. 474407Family c.1.8.3: beta-glycanases [51487] (22 proteins)
    consist of a number of sequence families
  6. 474678Protein Xylanase [51488] (5 species)
  7. 474682Species Bacillus stearothermophilus, Xt6 [TaxId:1422] [69386] (3 PDB entries)
  8. 474684Domain d1r87a_: 1r87 A: [104840]

Details for d1r87a_

PDB Entry: 1r87 (more details), 1.67 Å

PDB Description: crystal structure of the extracellular xylanase from geobacillus stearothermophilus t-6 (xt6, monoclinic form): the complex of the wt enzyme with xylopentaose at 1.67a resolution

SCOP Domain Sequences for d1r87a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r87a_ c.1.8.3 (A:) Xylanase {Bacillus stearothermophilus, Xt6}
kphisalnapqldqrykneftigaavepyqlqnekdvqmlkrhfnsivaenvmkpisiqp
eegkfnfeqadrivkfakangmdirfhtlvwhsqvpqwffldkegkpmvnetdpvkreqn
kqlllkrlethiktiverykddikywdvvnevvgddgklrnspwyqiagidyikvafqaa
rkyggdniklymndyntevepkrtalynlvkqlkeegvpidgighqshiqigwpseaeie
ktinmfaalgldnqiteldvsmygwpprayptydaipkqkfldqaarydrlfklyeklsd
kisnvtfwgiadnhtwldsradvyydangnvvvdpnapyakvekgkgkdapfvfgpdykv
kpaywaiidhk

SCOP Domain Coordinates for d1r87a_:

Click to download the PDB-style file with coordinates for d1r87a_.
(The format of our PDB-style files is described here.)

Timeline for d1r87a_: