SCOP 1.71: Domain d1r87a_: 1r87 A:

Lineage for d1r87a_ (1r87 A:)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (32 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (13 families)

5. Family c.1.8.3: beta-glycanases [51487] (22 proteins)
   consist of a number of sequence families

6. Protein Xylanase [51488] (5 species)

7. Species Bacillus stearothermophilus, Xt6 [TaxId:1422] [69386] (3 PDB entries)

8. Domain d1r87a_: 1r87 A: [104840]
   complexed with cl, so4, xys, zn

Details for d1r87a_

PDB Entry: 1r87, 1.67 Å

PDB Description: crystal structure of the extracellular xylanase from geobacillus stearothermophilus t-6 (xt6, monoclinic form): the complex of the wt enzyme with xylopentaose at 1.67a resolution

SCOP Domain Sequences for d1r87a_:

Sequence; same for both SEQRES and ATOM records:

>d1r87a_ c.1.8.3 (A:) Xylanase {Bacillus stearothermophilus, Xt6}
kphisalnapqldqrykneftigaavepyqlqnekdvqmlkrhfnsivaenvmkpisiqp
eegkfnfeqadrivkfakangmdirfhtlvwhsqvpqwffldkegkpmvnetdpvkreqn
kqlllkrlethiktiverykddikywdvvnevvgddgklrnspwyqiagidyikvafqaa
rkyggdniklymndyntevepkrtalynlvkqlkeegvpidgighqshiqigwpseaeie
ktinmfaalgldnqiteldvsmygwpprayptydaipkqkfldqaarydrlfklyeklsd
kisnvtfwgiadnhtwldsradvyydangnvvvdpnapyakvekgkgkdapfvfgpdykv
kpaywaiidhk

Timeline for d1r87a_:

• d1r87a_ first appeared in SCOP 1.69
  
• d1r87a_ appears in SCOP 1.73
  
• d1r87a_ appears in the current release, SCOPe 2.08