PDB entry 1r87

View 1r87 on RCSB PDB site
Description: crystal structure of the extracellular xylanase from geobacillus stearothermophilus t-6 (xt6, monoclinic form): the complex of the wt enzyme with xylopentaose at 1.67a resolution
Deposited on 2003-10-23, released 2004-07-20
The last revision prior to the SCOP 1.69 freeze date was dated 2004-07-20, with a file datestamp of 2004-07-20.
Experiment type: XRAY
Resolution: 1.67 Å
R-factor: 0.169
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1r87a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1r87A (A:)
    knadsyakkphisalnapqldqrykneftigaavepyqlqnekdvqmlkrhfnsivaenv
    mkpisiqpeegkfnfeqadrivkfakangmdirfhtlvwhsqvpqwffldkegkpmvnet
    dpvkreqnkqlllkrlethiktiverykddikywdvvnevvgddgklrnspwyqiagidy
    ikvafqaarkyggdniklymndyntevepkrtalynlvkqlkeegvpidgighqshiqig
    wpseaeiektinmfaalgldnqiteldvsmygwpprayptydaipkqkfldqaarydrlf
    klyeklsdkisnvtfwgiadnhtwldsradvyydangnvvvdpnapyakvekgkgkdapf
    vfgpdykvkpaywaiidhk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r87A (A:)
    kphisalnapqldqrykneftigaavepyqlqnekdvqmlkrhfnsivaenvmkpisiqp
    eegkfnfeqadrivkfakangmdirfhtlvwhsqvpqwffldkegkpmvnetdpvkreqn
    kqlllkrlethiktiverykddikywdvvnevvgddgklrnspwyqiagidyikvafqaa
    rkyggdniklymndyntevepkrtalynlvkqlkeegvpidgighqshiqigwpseaeie
    ktinmfaalgldnqiteldvsmygwpprayptydaipkqkfldqaarydrlfklyeklsd
    kisnvtfwgiadnhtwldsradvyydangnvvvdpnapyakvekgkgkdapfvfgpdykv
    kpaywaiidhk