![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.57: Molybdenum cofactor biosynthesis proteins [53217] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 5 strands; order: 21354, strand 5 is antiparallel to the rest; permutation of the Phosphorylase/hydrolase-like fold |
![]() | Superfamily c.57.1: Molybdenum cofactor biosynthesis proteins [53218] (3 families) ![]() |
![]() | Family c.57.1.1: MogA-like [53219] (6 proteins) |
![]() | Protein MoaB [89722] (2 species) |
![]() | Species Escherichia coli [TaxId:562] [89723] (2 PDB entries) Uniprot P30746 |
![]() | Domain d1r2ka_: 1r2k A: [104781] complexed with so4 |
PDB Entry: 1r2k (more details), 2.1 Å
SCOPe Domain Sequences for d1r2ka_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1r2ka_ c.57.1.1 (A:) MoaB {Escherichia coli [TaxId: 562]} qvstefiptriailtvsnrrgeeddtsghylrdsaqeaghhvvdkaivkenryairaqvs awiasddvqvvlitggtgltegdqapeallplfdrevegfgevfrmlsfeeigtstlqsr avagvanktlifampgstkacrtaweniiapqldartrpcnfhphlkk
Timeline for d1r2ka_: