Lineage for d1r2ka_ (1r2k A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2890089Fold c.57: Molybdenum cofactor biosynthesis proteins [53217] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 5 strands; order: 21354, strand 5 is antiparallel to the rest; permutation of the Phosphorylase/hydrolase-like fold
  4. 2890090Superfamily c.57.1: Molybdenum cofactor biosynthesis proteins [53218] (3 families) (S)
  5. 2890091Family c.57.1.1: MogA-like [53219] (6 proteins)
  6. 2890099Protein MoaB [89722] (2 species)
  7. 2890104Species Escherichia coli [TaxId:562] [89723] (2 PDB entries)
    Uniprot P30746
  8. 2890107Domain d1r2ka_: 1r2k A: [104781]
    complexed with so4

Details for d1r2ka_

PDB Entry: 1r2k (more details), 2.1 Å

PDB Description: Crystal structure of MoaB from Escherichia coli
PDB Compounds: (A:) Molybdenum cofactor biosynthesis protein B

SCOPe Domain Sequences for d1r2ka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r2ka_ c.57.1.1 (A:) MoaB {Escherichia coli [TaxId: 562]}
qvstefiptriailtvsnrrgeeddtsghylrdsaqeaghhvvdkaivkenryairaqvs
awiasddvqvvlitggtgltegdqapeallplfdrevegfgevfrmlsfeeigtstlqsr
avagvanktlifampgstkacrtaweniiapqldartrpcnfhphlkk

SCOPe Domain Coordinates for d1r2ka_:

Click to download the PDB-style file with coordinates for d1r2ka_.
(The format of our PDB-style files is described here.)

Timeline for d1r2ka_: