PDB entry 1r2k

View 1r2k on RCSB PDB site
Description: Crystal structure of MoaB from Escherichia coli
Class: biosynthetic protein
Keywords: alpha-beta, BIOSYNTHETIC PROTEIN
Deposited on 2003-09-28, released 2004-06-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.208
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Molybdenum cofactor biosynthesis protein B
    Species: Escherichia coli [TaxId:562]
    Gene: MOAB, CHLA2, B0782, Z1001, ECS0860
    Database cross-references and differences (RAF-indexed):
    • Uniprot P30746 (Start-168)
      • modified residue (106)
      • modified residue (134)
    Domains in SCOPe 2.07: d1r2ka_
  • Chain 'B':
    Compound: Molybdenum cofactor biosynthesis protein B
    Species: Escherichia coli [TaxId:562]
    Gene: MOAB, CHLA2, B0782, Z1001, ECS0860
    Database cross-references and differences (RAF-indexed):
    • Uniprot P30746 (Start-168)
      • modified residue (106)
      • modified residue (134)
    Domains in SCOPe 2.07: d1r2kb_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1r2kA (A:)
    sqvstefiptriailtvsnrrgeeddtsghylrdsaqeaghhvvdkaivkenryairaqv
    sawiasddvqvvlitggtgltegdqapeallplfdrevegfgevfrmlsfeeigtstlqs
    ravagvanktlifampgstkacrtaweniiapqldartrpcnfhphlkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r2kA (A:)
    qvstefiptriailtvsnrrgeeddtsghylrdsaqeaghhvvdkaivkenryairaqvs
    awiasddvqvvlitggtgltegdqapeallplfdrevegfgevfrmlsfeeigtstlqsr
    avagvanktlifampgstkacrtaweniiapqldartrpcnfhphlkk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1r2kB (B:)
    sqvstefiptriailtvsnrrgeeddtsghylrdsaqeaghhvvdkaivkenryairaqv
    sawiasddvqvvlitggtgltegdqapeallplfdrevegfgevfrmlsfeeigtstlqs
    ravagvanktlifampgstkacrtaweniiapqldartrpcnfhphlkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r2kB (B:)
    qvstefiptriailtvsnrrgeeddtsghylrdsaqeaghhvvdkaivkenryairaqvs
    awiasddvqvvlitggtgltegdqapeallplfdrevegfgevfrmlsfeeigtstlqsr
    avagvanktlifampgstkacrtaweniiapqldartrpcnfhphlkk