SCOPe 2.08: Domain d1r2kb_: 1r2k B:

Lineage for d1r2kb_ (1r2k B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.57: Molybdenum cofactor biosynthesis proteins [53217] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 5 strands; order: 21354, strand 5 is antiparallel to the rest; permutation of the Phosphorylase/hydrolase-like fold

4. Superfamily c.57.1: Molybdenum cofactor biosynthesis proteins [53218] (3 families)

5. Family c.57.1.1: MogA-like [53219] (6 proteins)

6. Protein MoaB [89722] (2 species)

7. Species Escherichia coli [TaxId:562] [89723] (2 PDB entries)
   Uniprot P30746

8. Domain d1r2kb_: 1r2k B: [104782]
   complexed with so4

Details for d1r2kb_

PDB Entry: 1r2k, 2.1 Å

PDB Description: Crystal structure of MoaB from Escherichia coli

PDB Compounds: (B:) Molybdenum cofactor biosynthesis protein B

SCOPe Domain Sequences for d1r2kb_:

Sequence; same for both SEQRES and ATOM records:

>d1r2kb_ c.57.1.1 (B:) MoaB {Escherichia coli [TaxId: 562]}
qvstefiptriailtvsnrrgeeddtsghylrdsaqeaghhvvdkaivkenryairaqvs
awiasddvqvvlitggtgltegdqapeallplfdrevegfgevfrmlsfeeigtstlqsr
avagvanktlifampgstkacrtaweniiapqldartrpcnfhphlkk

Timeline for d1r2kb_:

• d1r2kb_ first appeared in SCOP 1.69
  
• d1r2kb_ appears in SCOPe 2.07