Lineage for d1r2ka_ (1r2k A:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 489418Fold c.57: Molybdenum cofactor biosynthesis proteins [53217] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 5 strands; order: 21354, strand 5 is antiparallel to the rest; permutation of the Phosphorylase/hydrolase-like fold
  4. 489419Superfamily c.57.1: Molybdenum cofactor biosynthesis proteins [53218] (2 families) (S)
  5. 489420Family c.57.1.1: MogA-like [53219] (4 proteins)
  6. 489428Protein MoaB [89722] (1 species)
  7. 489429Species Escherichia coli [TaxId:562] [89723] (2 PDB entries)
  8. 489432Domain d1r2ka_: 1r2k A: [104781]

Details for d1r2ka_

PDB Entry: 1r2k (more details), 2.1 Å

PDB Description: Crystal structure of MoaB from Escherichia coli

SCOP Domain Sequences for d1r2ka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r2ka_ c.57.1.1 (A:) MoaB {Escherichia coli}
qvstefiptriailtvsnrrgeeddtsghylrdsaqeaghhvvdkaivkenryairaqvs
awiasddvqvvlitggtgltegdqapeallplfdrevegfgevfrmlsfeeigtstlqsr
avagvanktlifampgstkacrtaweniiapqldartrpcnfhphlkk

SCOP Domain Coordinates for d1r2ka_:

Click to download the PDB-style file with coordinates for d1r2ka_.
(The format of our PDB-style files is described here.)

Timeline for d1r2ka_: