Lineage for d1r0mc2 (1r0m C:6-132)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. Family d.54.1.1: Enolase N-terminal domain-like [54827] (15 proteins)
    C-terminal domain is beta/alpha-barrel
  6. Protein N-acylamino acid racemase [110937] (4 species)
  7. Species Deinococcus radiodurans [TaxId:1299] [110939] (5 PDB entries)
    Uniprot Q9RYA6
  8. Domain d1r0mc2: 1r0m C:6-132 [104752]
    Other proteins in same PDB: d1r0ma1, d1r0mb1, d1r0mc1, d1r0md1

Details for d1r0mc2

PDB Entry: 1r0m (more details), 1.3 Å

PDB Description: Structure of Deinococcus radiodurans N-acylamino acid racemase at 1.3 : insights into a flexible binding pocket and evolution of enzymatic activity
PDB Compounds: (C:) N-acylamino acid racemase

SCOPe Domain Sequences for d1r0mc2:

Sequence, based on SEQRES records: (download)

>d1r0mc2 d.54.1.1 (C:6-132) N-acylamino acid racemase {Deinococcus radiodurans [TaxId: 1299]}
rmfkieaaeivvarlplkfrfetsfgvqthkvvpllilhgegvqgvaegtmearpmyree
tiagaldllrgtflpailgqtfanpeavsdalgsyrgnrmaramvemaawdlwartlgvp
lgtllgg

Sequence, based on observed residues (ATOM records): (download)

>d1r0mc2 d.54.1.1 (C:6-132) N-acylamino acid racemase {Deinococcus radiodurans [TaxId: 1299]}
rmfkieaaeivvarlplkthkvvpllilhgegvqgvaegtmearpmyreetiagaldllr
gtflpailgqtfanpeavsdalgsyrgnrmaramvemaawdlwartlgvplgtllgg

SCOPe Domain Coordinates for d1r0mc2 are not available.

Timeline for d1r0mc2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1r0mc1
View in 3D
Domains from other chains:
(mouse over for more information)
d1r0ma1, d1r0ma2, d1r0mb1, d1r0mb2, d1r0md1, d1r0md2