Lineage for d1r0ma1 (1r0m A:133-375)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2836768Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) (S)
    binds metal ion (magnesium or manganese) in conserved site inside barrel
    N-terminal alpha+beta domain is common to this superfamily
  5. 2836928Family c.1.11.2: D-glucarate dehydratase-like [51609] (15 proteins)
  6. 2837049Protein N-acylamino acid racemase [110372] (4 species)
  7. 2837067Species Deinococcus radiodurans [TaxId:1299] [110374] (5 PDB entries)
    Uniprot Q9RYA6
  8. 2837068Domain d1r0ma1: 1r0m A:133-375 [104747]
    Other proteins in same PDB: d1r0ma2, d1r0mb2, d1r0mc2, d1r0md2

Details for d1r0ma1

PDB Entry: 1r0m (more details), 1.3 Å

PDB Description: Structure of Deinococcus radiodurans N-acylamino acid racemase at 1.3 : insights into a flexible binding pocket and evolution of enzymatic activity
PDB Compounds: (A:) N-acylamino acid racemase

SCOPe Domain Sequences for d1r0ma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r0ma1 c.1.11.2 (A:133-375) N-acylamino acid racemase {Deinococcus radiodurans [TaxId: 1299]}
hkeqvevgvslgiqadeqatvdlvrrhveqgyrriklkikpgwdvqpvratreafpdirl
tvdansaytladagrlrqldeydltyieqplawddlvdhaelarrirtplcldesvasas
darkalalgaggvinlkvarvgghaesrrvhdvaqsfgapvwcggmlesgigrahnihls
tlsnfrlpgdtssasrywerdliqepleavdglmpvpqgpgtgvtldreflatvteaqee
hra

SCOPe Domain Coordinates for d1r0ma1:

Click to download the PDB-style file with coordinates for d1r0ma1.
(The format of our PDB-style files is described here.)

Timeline for d1r0ma1: