SCOP 1.69: Domain d1qz2c2: 1qz2 C:145-257

Lineage for d1qz2c2 (1qz2 C:145-257)

1. Root: SCOP 1.69

2. Class d: Alpha and beta proteins (a+b) [53931] (279 folds)

3. Fold d.26: FKBP-like [54533] (3 superfamilies)
   core: beta(2)-alpha-beta(2); antiparallel beta-sheet

4. Superfamily d.26.1: FKBP-like [54534] (3 families)

5. Family d.26.1.1: FKBP immunophilin/proline isomerase [54535] (16 proteins)

6. Protein FKBP52, N-terminal domain [82619] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [82620] (4 PDB entries)

8. Domain d1qz2c2: 1qz2 C:145-257 [104668]
   Other proteins in same PDB: d1qz2a1, d1qz2b1, d1qz2c1
   second FKPB domain

Details for d1qz2c2

PDB Entry: 1qz2, 3 Å

PDB Description: Crystal Structure of FKBP52 C-terminal Domain complex with the C-terminal peptide MEEVD of Hsp90

SCOP Domain Sequences for d1qz2c2:

Sequence; same for both SEQRES and ATOM records:

>d1qz2c2 d.26.1.1 (C:145-257) FKBP52, N-terminal domain {Human (Homo sapiens)}
eedggiirriqtrgegyakpnegaivevalegyykdklfdqrelrfeigegenldlpygl
eraiqrmekgehsivylkpsyafgsvgkekfqippnaelkyelhlksfekake

Timeline for d1qz2c2:

• d1qz2c2 is new in SCOP 1.69
  
• d1qz2c2 appears in SCOP 1.71
  
• d1qz2c2 appears in the current release, SCOPe 2.08