![]() | Class d: Alpha and beta proteins (a+b) [53931] (279 folds) |
![]() | Fold d.26: FKBP-like [54533] (3 superfamilies) core: beta(2)-alpha-beta(2); antiparallel beta-sheet |
![]() | Superfamily d.26.1: FKBP-like [54534] (3 families) ![]() |
![]() | Family d.26.1.1: FKBP immunophilin/proline isomerase [54535] (16 proteins) |
![]() | Protein FKBP52, N-terminal domain [82619] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [82620] (4 PDB entries) |
![]() | Domain d1qz2b2: 1qz2 B:145-257 [104666] Other proteins in same PDB: d1qz2a1, d1qz2b1, d1qz2c1 |
PDB Entry: 1qz2 (more details), 3 Å
SCOP Domain Sequences for d1qz2b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qz2b2 d.26.1.1 (B:145-257) FKBP52, N-terminal domain {Human (Homo sapiens)} eedggiirriqtrgegyakpnegaivevalegyykdklfdqrelrfeigegenldlpygl eraiqrmekgehsivylkpsyafgsvgkekfqippnaelkyelhlksfekake
Timeline for d1qz2b2:
![]() Domains from other chains: (mouse over for more information) d1qz2a1, d1qz2a2, d1qz2c1, d1qz2c2 |