PDB entry 1qz2

View 1qz2 on RCSB PDB site
Description: Crystal Structure of FKBP52 C-terminal Domain complex with the C-terminal peptide MEEVD of Hsp90
Deposited on 2003-09-15, released 2004-06-22
The last revision prior to the SCOP 1.69 freeze date was dated 2004-06-22, with a file datestamp of 2004-06-22.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.23
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1qz2A (A:)
    mgsshhhhhhssglvprgshmeedggiirriqtrgegyakpnegaivevalegyykdklf
    dqrelrfeigegenldlpygleraiqrmekgehsivylkpsyafgsvgkekfqippnael
    kyelhlksfekakeswemnseekleqstivkergtvyfkegkykqallqykkivswleye
    ssfsneeaqkaqalrlashlnlamchlklqafsaaiescnkaleldsnnekglfrrgeah
    lavndfelaradfqkvlqlypnnkaaktqlavcqqrirrqlarekklyanmferlaeeen
    kakaeassgdhptdtemkeeqksntagsqsqvetea
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qz2A (A:)
    gshmeedggiirriqtrgegyakpnegaivevalegyykdklfdqrelrfeigegenldl
    pygleraiqrmekgehsivylkpsyafgsvgkekfqippnaelkyelhlksfekakeswe
    mnseekleqstivkergtvyfkegkykqallqykkivswleyessfsneeaqkaqalrla
    shlnlamchlklqafsaaiescnkaleldsnnekglfrrgeahlavndfelaradfqkvl
    qlypnnkaaktqlavcqqrirrqlarekklyanmferlaeeenka
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1qz2B (B:)
    mgsshhhhhhssglvprgshmeedggiirriqtrgegyakpnegaivevalegyykdklf
    dqrelrfeigegenldlpygleraiqrmekgehsivylkpsyafgsvgkekfqippnael
    kyelhlksfekakeswemnseekleqstivkergtvyfkegkykqallqykkivswleye
    ssfsneeaqkaqalrlashlnlamchlklqafsaaiescnkaleldsnnekglfrrgeah
    lavndfelaradfqkvlqlypnnkaaktqlavcqqrirrqlarekklyanmferlaeeen
    kakaeassgdhptdtemkeeqksntagsqsqvetea
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qz2B (B:)
    gshmeedggiirriqtrgegyakpnegaivevalegyykdklfdqrelrfeigegenldl
    pygleraiqrmekgehsivylkpsyafgsvgkekfqippnaelkyelhlksfekakeswe
    mnseekleqstivkergtvyfkegkykqallqykkivswleyessfsneeaqkaqalrla
    shlnlamchlklqafsaaiescnkaleldsnnekglfrrgeahlavndfelaradfqkvl
    qlypnnkaaktqlavcqqrirrqlarekklyanmferlaeeenka
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1qz2C (C:)
    mgsshhhhhhssglvprgshmeedggiirriqtrgegyakpnegaivevalegyykdklf
    dqrelrfeigegenldlpygleraiqrmekgehsivylkpsyafgsvgkekfqippnael
    kyelhlksfekakeswemnseekleqstivkergtvyfkegkykqallqykkivswleye
    ssfsneeaqkaqalrlashlnlamchlklqafsaaiescnkaleldsnnekglfrrgeah
    lavndfelaradfqkvlqlypnnkaaktqlavcqqrirrqlarekklyanmferlaeeen
    kakaeassgdhptdtemkeeqksntagsqsqvetea
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qz2C (C:)
    gshmeedggiirriqtrgegyakpnegaivevalegyykdklfdqrelrfeigegenldl
    pygleraiqrmekgehsivylkpsyafgsvgkekfqippnaelkyelhlksfekakeswe
    mnseekleqstivkergtvyfkegkykqallqykkivswleyessfsneeaqkaqalrla
    shlnlamchlklqafsaaiescnkaleldsnnekglfrrgeahlavndfelaradfqkvl
    qlypnnkaaktqlavcqqrirrqlarekklyanmferlaeeenka