Lineage for d1qz2a2 (1qz2 A:145-257)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 501849Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 501850Superfamily d.26.1: FKBP-like [54534] (3 families) (S)
  5. 501851Family d.26.1.1: FKBP immunophilin/proline isomerase [54535] (16 protein domains)
  6. 501933Protein FKBP52, N-terminal domain [82619] (1 species)
  7. 501934Species Human (Homo sapiens) [TaxId:9606] [82620] (4 PDB entries)
  8. 501942Domain d1qz2a2: 1qz2 A:145-257 [104664]
    Other proteins in same PDB: d1qz2a1, d1qz2b1, d1qz2c1

Details for d1qz2a2

PDB Entry: 1qz2 (more details), 3 Å

PDB Description: Crystal Structure of FKBP52 C-terminal Domain complex with the C-terminal peptide MEEVD of Hsp90

SCOP Domain Sequences for d1qz2a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qz2a2 d.26.1.1 (A:145-257) FKBP52, N-terminal domain {Human (Homo sapiens)}
eedggiirriqtrgegyakpnegaivevalegyykdklfdqrelrfeigegenldlpygl
eraiqrmekgehsivylkpsyafgsvgkekfqippnaelkyelhlksfekake

SCOP Domain Coordinates for d1qz2a2:

Click to download the PDB-style file with coordinates for d1qz2a2.
(The format of our PDB-style files is described here.)

Timeline for d1qz2a2: