Lineage for d1qvte2 (1qvt E:73-187)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2008141Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
    multihelical; interlocked (homo)dimer
  4. 2008142Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families) (S)
  5. 2008143Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 protein domains)
  6. 2008196Protein Multidrug binding protein QacR [69107] (1 species)
  7. 2008197Species Staphylococcus aureus [TaxId:1280] [69108] (24 PDB entries)
    Uniprot P23217
  8. 2008255Domain d1qvte2: 1qvt E:73-187 [104609]
    Other proteins in same PDB: d1qvta1, d1qvtb1, d1qvtd1, d1qvte1
    complexed with prl, so4

Details for d1qvte2

PDB Entry: 1qvt (more details), 2.89 Å

PDB Description: crystal structure of the multidrug binding transcriptional repressor qacr bound to the drug proflavine
PDB Compounds: (E:) Transcriptional regulator qacR

SCOPe Domain Sequences for d1qvte2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qvte2 a.121.1.1 (E:73-187) Multidrug binding protein QacR {Staphylococcus aureus [TaxId: 1280]}
ktnrekfylynelsltteyyyplqnaiiefyteyyktnsinekmnklenkyidayhvifk
egnlngewsindvnavskiaanavngivtftheqnineriklmnkfsqiflngls

SCOPe Domain Coordinates for d1qvte2:

Click to download the PDB-style file with coordinates for d1qvte2.
(The format of our PDB-style files is described here.)

Timeline for d1qvte2: