SCOPe 2.07: Domain d1qvte2: 1qvt E:73-187

Lineage for d1qvte2 (1qvt E:73-187)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
   multihelical; interlocked (homo)dimer

4. Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families)

5. Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 proteins)

6. Protein Multidrug binding protein QacR [69107] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [69108] (24 PDB entries)
   Uniprot P23217

8. Domain d1qvte2: 1qvt E:73-187 [104609]
   Other proteins in same PDB: d1qvta1, d1qvtb1, d1qvtd1, d1qvte1
   complexed with prl, so4

Details for d1qvte2

PDB Entry: 1qvt, 2.89 Å

PDB Description: crystal structure of the multidrug binding transcriptional repressor qacr bound to the drug proflavine

PDB Compounds: (E:) Transcriptional regulator qacR

SCOPe Domain Sequences for d1qvte2:

Sequence; same for both SEQRES and ATOM records:

>d1qvte2 a.121.1.1 (E:73-187) Multidrug binding protein QacR {Staphylococcus aureus [TaxId: 1280]}
ktnrekfylynelsltteyyyplqnaiiefyteyyktnsinekmnklenkyidayhvifk
egnlngewsindvnavskiaanavngivtftheqnineriklmnkfsqiflngls

Timeline for d1qvte2:

• d1qvte2 first appeared in SCOP 1.69
  
• d1qvte2 appears in SCOPe 2.06
  
• d1qvte2 appears in the current release, SCOPe 2.08