PDB entry 1qvt

View 1qvt on RCSB PDB site
Description: crystal structure of the multidrug binding transcriptional repressor qacr bound to the drug proflavine
Class: transcription
Keywords: multidrug binding protein, repressor, transcription, QacR
Deposited on 2003-08-28, released 2004-08-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.89 Å
R-factor: 0.232
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transcriptional regulator qacR
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: QACR OR SAVP031
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A0N4
      • conflict (140)
    Domains in SCOPe 2.07: d1qvta1, d1qvta2
  • Chain 'B':
    Compound: Transcriptional regulator qacR
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: QACR OR SAVP031
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A0N4
      • conflict (140)
    Domains in SCOPe 2.07: d1qvtb1, d1qvtb2
  • Chain 'D':
    Compound: Transcriptional regulator qacR
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: QACR OR SAVP031
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A0N4
      • conflict (140)
    Domains in SCOPe 2.07: d1qvtd1, d1qvtd2
  • Chain 'E':
    Compound: Transcriptional regulator qacR
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: QACR OR SAVP031
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A0N4
      • conflict (140)
    Domains in SCOPe 2.07: d1qvte1, d1qvte2
  • Heterogens: SO4, PRL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1qvtA (A:)
    mnlkdkilgvakelfikngynatttgeivklsesskgnlyyhfktkenlfleilnieesk
    wqeqwkkeqikcktnrekfylynelsltteyyyplqnaiiefyteyyktnsinekmnkle
    nkyidayhvifkegnlngewsindvnavskiaanavngivtftheqnineriklmnkfsq
    iflnglskhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qvtA (A:)
    nlkdkilgvakelfikngynatttgeivklsesskgnlyyhfktkenlfleilnieeskw
    qeqwkkeqikcktnrekfylynelsltteyyyplqnaiiefyteyyktnsinekmnklen
    kyidayhvifkegnlngewsindvnavskiaanavngivtftheqnineriklmnkfsqi
    flngls
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1qvtB (B:)
    mnlkdkilgvakelfikngynatttgeivklsesskgnlyyhfktkenlfleilnieesk
    wqeqwkkeqikcktnrekfylynelsltteyyyplqnaiiefyteyyktnsinekmnkle
    nkyidayhvifkegnlngewsindvnavskiaanavngivtftheqnineriklmnkfsq
    iflnglskhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qvtB (B:)
    nlkdkilgvakelfikngynatttgeivklsesskgnlyyhfktkenlfleilnieeskw
    qeqwkkeqikcktnrekfylynelsltteyyyplqnaiiefyteyyktnsinekmnklen
    kyidayhvifkegnlngewsindvnavskiaanavngivtftheqnineriklmnkfsqi
    flngls
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1qvtD (D:)
    mnlkdkilgvakelfikngynatttgeivklsesskgnlyyhfktkenlfleilnieesk
    wqeqwkkeqikcktnrekfylynelsltteyyyplqnaiiefyteyyktnsinekmnkle
    nkyidayhvifkegnlngewsindvnavskiaanavngivtftheqnineriklmnkfsq
    iflnglskhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qvtD (D:)
    nlkdkilgvakelfikngynatttgeivklsesskgnlyyhfktkenlfleilnieeskw
    qeqwkkeqikcktnrekfylynelsltteyyyplqnaiiefyteyyktnsinekmnklen
    kyidayhvifkegnlngewsindvnavskiaanavngivtftheqnineriklmnkfsqi
    flngls
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1qvtE (E:)
    mnlkdkilgvakelfikngynatttgeivklsesskgnlyyhfktkenlfleilnieesk
    wqeqwkkeqikcktnrekfylynelsltteyyyplqnaiiefyteyyktnsinekmnkle
    nkyidayhvifkegnlngewsindvnavskiaanavngivtftheqnineriklmnkfsq
    iflnglskhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1qvtE (E:)
    nlkdkilgvakelfikngynatttgeivklsesskgnlyyhfktkenlfleilnieeskw
    qeqwkkeqikcktnrekfylynelsltteyyyplqnaiiefyteyyktnsinekmnklen
    kyidayhvifkegnlngewsindvnavskiaanavngivtftheqnineriklmnkfsqi
    flngls