Lineage for d1q5mb_ (1q5m B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2437818Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (2 families) (S)
  5. 2437819Family c.1.7.1: Aldo-keto reductases (NADP) [51431] (16 proteins)
    Common fold covers whole protein structure
  6. 2437831Protein 20alpha-hydroxysteroid dehydrogenase [109609] (2 species)
  7. 2437834Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [110348] (2 PDB entries)
    Uniprot P80508
  8. 2437836Domain d1q5mb_: 1q5m B: [104540]
    complexed with ndp, so4

Details for d1q5mb_

PDB Entry: 1q5m (more details), 1.32 Å

PDB Description: binary complex of rabbit 20alpha-hydroxysteroid dehydrogenase with nadph
PDB Compounds: (B:) Prostaglandin-E2 9-reductase

SCOPe Domain Sequences for d1q5mb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q5mb_ c.1.7.1 (B:) 20alpha-hydroxysteroid dehydrogenase {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
dpkfqrvalsdghfipvlgfgtyapeevpkskameatkiaidagfrhidsayfyknekev
glairskiadgtvkredifytsklwctfhrpelvrpsledslknlqldyvdlyiihfpta
lkpgveiiptdehgkaifdtvdicatweamekckdaglaksigvsnfnrrqlemilnkpg
lkykpvcnqvechpylnqgkllefckskgivlvaysalgshrepewvdqsapvlledpli
galakkhqqtpalialryqlqrgivvlaksftekrikeniqvfefqlpsedmkvidslnr
nfryvtadfaighpnypfsdey

SCOPe Domain Coordinates for d1q5mb_:

Click to download the PDB-style file with coordinates for d1q5mb_.
(The format of our PDB-style files is described here.)

Timeline for d1q5mb_: