Lineage for d1q5mb_ (1q5m B:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 473233Fold c.1: TIM beta/alpha-barrel [51350] (31 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 473932Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (1 family) (S)
  5. 473933Family c.1.7.1: Aldo-keto reductases (NADP) [51431] (15 proteins)
    Common fold covers whole protein structure
  6. 473942Protein 20alpha-hydroxysteroid dehydrogenase [109609] (2 species)
  7. 473945Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [110348] (1 PDB entry)
  8. 473947Domain d1q5mb_: 1q5m B: [104540]

Details for d1q5mb_

PDB Entry: 1q5m (more details), 1.32 Å

PDB Description: binary complex of rabbit 20alpha-hydroxysteroid dehydrogenase with nadph

SCOP Domain Sequences for d1q5mb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q5mb_ c.1.7.1 (B:) 20alpha-hydroxysteroid dehydrogenase {Rabbit (Oryctolagus cuniculus)}
dpkfqrvalsdghfipvlgfgtyapeevpkskameatkiaidagfrhidsayfyknekev
glairskiadgtvkredifytsklwctfhrpelvrpsledslknlqldyvdlyiihfpta
lkpgveiiptdehgkaifdtvdicatweamekckdaglaksigvsnfnrrqlemilnkpg
lkykpvcnqvechpylnqgkllefckskgivlvaysalgshrepewvdqsapvlledpli
galakkhqqtpalialryqlqrgivvlaksftekrikeniqvfefqlpsedmkvidslnr
nfryvtadfaighpnypfsdey

SCOP Domain Coordinates for d1q5mb_:

Click to download the PDB-style file with coordinates for d1q5mb_.
(The format of our PDB-style files is described here.)

Timeline for d1q5mb_: