Class a: All alpha proteins [46456] (290 folds) |
Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies) core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down |
Superfamily a.24.22: Nickel-containing superoxide dismutase, NiSOD [109770] (1 family) automatically mapped to Pfam PF09055 |
Family a.24.22.1: Nickel-containing superoxide dismutase, NiSOD [109771] (2 proteins) |
Protein Nickel-containing superoxide dismutase, NiSOD [109772] (2 species) |
Species Streptomyces seoulensis [TaxId:73044] [109773] (5 PDB entries) Uniprot P80734 |
Domain d1q0kf_: 1q0k F: [104448] complexed with ni, so4, thj |
PDB Entry: 1q0k (more details), 2.1 Å
SCOPe Domain Sequences for d1q0kf_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1q0kf_ a.24.22.1 (F:) Nickel-containing superoxide dismutase, NiSOD {Streptomyces seoulensis [TaxId: 73044]} hcdlpcgvydpaqarieaesvkaiqekmaanddlhfqiratvikeqraelakhhldvlws dyfkpphfesypelhtlvneavkalsaakastdpatgqkaldyiaqidkifwetkka
Timeline for d1q0kf_: