PDB entry 1q0k

View 1q0k on RCSB PDB site
Description: Crystal structure of Ni-containing superoxide dismutase with Ni-ligation corresponding to the thiosulfate-reduced state
Class: oxidoreductase
Keywords: homohexamer of four-helix bundles, oxidoreductase
Deposited on 2003-07-16, released 2004-05-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.204
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Superoxide dismutase [Ni]
    Species: Streptomyces seoulensis [TaxId:73044]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1q0ka_
  • Chain 'B':
    Compound: Superoxide dismutase [Ni]
    Species: Streptomyces seoulensis [TaxId:73044]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1q0kb_
  • Chain 'C':
    Compound: Superoxide dismutase [Ni]
    Species: Streptomyces seoulensis [TaxId:73044]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1q0kc_
  • Chain 'D':
    Compound: Superoxide dismutase [Ni]
    Species: Streptomyces seoulensis [TaxId:73044]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1q0kd_
  • Chain 'E':
    Compound: Superoxide dismutase [Ni]
    Species: Streptomyces seoulensis [TaxId:73044]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1q0ke_
  • Chain 'F':
    Compound: Superoxide dismutase [Ni]
    Species: Streptomyces seoulensis [TaxId:73044]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1q0kf_
  • Chain 'G':
    Compound: Superoxide dismutase [Ni]
    Species: Streptomyces seoulensis [TaxId:73044]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1q0kg_
  • Chain 'H':
    Compound: Superoxide dismutase [Ni]
    Species: Streptomyces seoulensis [TaxId:73044]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1q0kh_
  • Chain 'I':
    Compound: Superoxide dismutase [Ni]
    Species: Streptomyces seoulensis [TaxId:73044]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1q0ki_
  • Chain 'J':
    Compound: Superoxide dismutase [Ni]
    Species: Streptomyces seoulensis [TaxId:73044]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1q0kj_
  • Chain 'K':
    Compound: Superoxide dismutase [Ni]
    Species: Streptomyces seoulensis [TaxId:73044]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1q0kk_
  • Chain 'L':
    Compound: Superoxide dismutase [Ni]
    Species: Streptomyces seoulensis [TaxId:73044]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1q0kl_
  • Heterogens: NI, SO4, THJ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1q0kA (A:)
    hcdlpcgvydpaqarieaesvkaiqekmaanddlhfqiratvikeqraelakhhldvlws
    dyfkpphfesypelhtlvneavkalsaakastdpatgqkaldyiaqidkifwetkka
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1q0kB (B:)
    hcdlpcgvydpaqarieaesvkaiqekmaanddlhfqiratvikeqraelakhhldvlws
    dyfkpphfesypelhtlvneavkalsaakastdpatgqkaldyiaqidkifwetkka
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1q0kC (C:)
    hcdlpcgvydpaqarieaesvkaiqekmaanddlhfqiratvikeqraelakhhldvlws
    dyfkpphfesypelhtlvneavkalsaakastdpatgqkaldyiaqidkifwetkka
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1q0kD (D:)
    hcdlpcgvydpaqarieaesvkaiqekmaanddlhfqiratvikeqraelakhhldvlws
    dyfkpphfesypelhtlvneavkalsaakastdpatgqkaldyiaqidkifwetkka
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1q0kE (E:)
    hcdlpcgvydpaqarieaesvkaiqekmaanddlhfqiratvikeqraelakhhldvlws
    dyfkpphfesypelhtlvneavkalsaakastdpatgqkaldyiaqidkifwetkka
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1q0kF (F:)
    hcdlpcgvydpaqarieaesvkaiqekmaanddlhfqiratvikeqraelakhhldvlws
    dyfkpphfesypelhtlvneavkalsaakastdpatgqkaldyiaqidkifwetkka
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1q0kG (G:)
    hcdlpcgvydpaqarieaesvkaiqekmaanddlhfqiratvikeqraelakhhldvlws
    dyfkpphfesypelhtlvneavkalsaakastdpatgqkaldyiaqidkifwetkka
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1q0kH (H:)
    hcdlpcgvydpaqarieaesvkaiqekmaanddlhfqiratvikeqraelakhhldvlws
    dyfkpphfesypelhtlvneavkalsaakastdpatgqkaldyiaqidkifwetkka
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1q0kI (I:)
    hcdlpcgvydpaqarieaesvkaiqekmaanddlhfqiratvikeqraelakhhldvlws
    dyfkpphfesypelhtlvneavkalsaakastdpatgqkaldyiaqidkifwetkka
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1q0kJ (J:)
    hcdlpcgvydpaqarieaesvkaiqekmaanddlhfqiratvikeqraelakhhldvlws
    dyfkpphfesypelhtlvneavkalsaakastdpatgqkaldyiaqidkifwetkka
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1q0kK (K:)
    hcdlpcgvydpaqarieaesvkaiqekmaanddlhfqiratvikeqraelakhhldvlws
    dyfkpphfesypelhtlvneavkalsaakastdpatgqkaldyiaqidkifwetkka
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1q0kL (L:)
    hcdlpcgvydpaqarieaesvkaiqekmaanddlhfqiratvikeqraelakhhldvlws
    dyfkpphfesypelhtlvneavkalsaakastdpatgqkaldyiaqidkifwetkka