Lineage for d1q0gb_ (1q0g B:)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. Superfamily a.24.22: Nickel-containing superoxide dismutase, NiSOD [109770] (1 family) (S)
    automatically mapped to Pfam PF09055
  5. Family a.24.22.1: Nickel-containing superoxide dismutase, NiSOD [109771] (2 proteins)
  6. Protein Nickel-containing superoxide dismutase, NiSOD [109772] (2 species)
  7. Species Streptomyces seoulensis [TaxId:73044] [109773] (5 PDB entries)
    Uniprot P80734
  8. Domain d1q0gb_: 1q0g B: [104429]
    complexed with ni, so4

Details for d1q0gb_

PDB Entry: 1q0g (more details), 1.6 Å

PDB Description: Crystal structure of Ni-containing superoxide dismutase with Ni-ligation corresponding to the state after full x-ray-induced reduction
PDB Compounds: (B:) Superoxide dismutase [Ni]

SCOPe Domain Sequences for d1q0gb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q0gb_ a.24.22.1 (B:) Nickel-containing superoxide dismutase, NiSOD {Streptomyces seoulensis [TaxId: 73044]}
hcdlpcgvydpaqarieaesvkaiqekmaanddlhfqiratvikeqraelakhhldvlws
dyfkpphfesypelhtlvneavkalsaakastdpatgqkaldyiaqidkifwetkka

SCOPe Domain Coordinates for d1q0gb_ are not available.

Timeline for d1q0gb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1q0ga_, d1q0gc_, d1q0gd_, d1q0ge_, d1q0gf_, d1q0gg_, d1q0gh_, d1q0gi_, d1q0gj_, d1q0gk_, d1q0gl_