Lineage for d1q0gh_ (1q0g H:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2699446Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 2700648Superfamily a.24.22: Nickel-containing superoxide dismutase, NiSOD [109770] (1 family) (S)
    automatically mapped to Pfam PF09055
  5. 2700649Family a.24.22.1: Nickel-containing superoxide dismutase, NiSOD [109771] (2 proteins)
  6. 2700650Protein Nickel-containing superoxide dismutase, NiSOD [109772] (2 species)
  7. 2700670Species Streptomyces seoulensis [TaxId:73044] [109773] (5 PDB entries)
    Uniprot P80734
  8. 2700678Domain d1q0gh_: 1q0g H: [104435]
    complexed with ni, so4

Details for d1q0gh_

PDB Entry: 1q0g (more details), 1.6 Å

PDB Description: Crystal structure of Ni-containing superoxide dismutase with Ni-ligation corresponding to the state after full x-ray-induced reduction
PDB Compounds: (H:) Superoxide dismutase [Ni]

SCOPe Domain Sequences for d1q0gh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q0gh_ a.24.22.1 (H:) Nickel-containing superoxide dismutase, NiSOD {Streptomyces seoulensis [TaxId: 73044]}
hcdlpcgvydpaqarieaesvkaiqekmaanddlhfqiratvikeqraelakhhldvlws
dyfkpphfesypelhtlvneavkalsaakastdpatgqkaldyiaqidkifwetkka

SCOPe Domain Coordinates for d1q0gh_:

Click to download the PDB-style file with coordinates for d1q0gh_.
(The format of our PDB-style files is described here.)

Timeline for d1q0gh_: