Lineage for d1px4d3 (1px4 D:13-219)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2774100Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2774101Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 2774233Family b.18.1.5: beta-Galactosidase/glucuronidase, N-terminal domain [49803] (4 proteins)
  6. 2774234Protein beta-Galactosidase [49804] (3 species)
  7. 2774242Species Escherichia coli [TaxId:562] [49805] (46 PDB entries)
    Uniprot P00722
  8. 2774262Domain d1px4d3: 1px4 D:13-219 [104378]
    Other proteins in same PDB: d1px4a1, d1px4a2, d1px4a4, d1px4a5, d1px4b1, d1px4b2, d1px4b4, d1px4b5, d1px4c1, d1px4c2, d1px4c4, d1px4c5, d1px4d1, d1px4d2, d1px4d4, d1px4d5
    complexed with dms, ipt, mg, na

Details for d1px4d3

PDB Entry: 1px4 (more details), 1.6 Å

PDB Description: e. coli (lacz) beta-galactosidase (g794a) with iptg bound
PDB Compounds: (D:) beta-galactosidase

SCOPe Domain Sequences for d1px4d3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1px4d3 b.18.1.5 (D:13-219) beta-Galactosidase {Escherichia coli [TaxId: 562]}
rrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfawfpapeavpes
wlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptgcysltfnvdes
wlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflragenrlavmvlrws
dgsyledqdmwrmsgifrdvsllhkpt

SCOPe Domain Coordinates for d1px4d3:

Click to download the PDB-style file with coordinates for d1px4d3.
(The format of our PDB-style files is described here.)

Timeline for d1px4d3: