Lineage for d1px4d5 (1px4 D:334-625)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2829818Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2830557Family c.1.8.3: beta-glycanases [51487] (27 proteins)
    consist of a number of sequence families
  6. 2830645Protein beta-Galactosidase, domain 3 [51510] (3 species)
  7. 2830653Species Escherichia coli [TaxId:562] [51511] (46 PDB entries)
    Uniprot P00722
  8. 2830673Domain d1px4d5: 1px4 D:334-625 [104380]
    Other proteins in same PDB: d1px4a1, d1px4a2, d1px4a3, d1px4a4, d1px4b1, d1px4b2, d1px4b3, d1px4b4, d1px4c1, d1px4c2, d1px4c3, d1px4c4, d1px4d1, d1px4d2, d1px4d3, d1px4d4
    complexed with dms, ipt, mg, na

Details for d1px4d5

PDB Entry: 1px4 (more details), 1.6 Å

PDB Description: e. coli (lacz) beta-galactosidase (g794a) with iptg bound
PDB Compounds: (D:) beta-galactosidase

SCOPe Domain Sequences for d1px4d5:

Sequence; same for both SEQRES and ATOM records: (download)

>d1px4d5 c.1.8.3 (D:334-625) beta-Galactosidase, domain 3 {Escherichia coli [TaxId: 562]}
evriengllllngkpllirgvnrhehhplhgqvmdeqtmvqdillmkqnnfnavrcshyp
nhplwytlcdryglyvvdeaniethgmvpmnrltddprwlpamservtrmvqrdrnhpsv
iiwslgnesghganhdalyrwiksvdpsrpvqyegggadttatdiicpmyarvdedqpfp
avpkwsikkwlslpgetrplilceyahamgnslggfakywqafrqyprlqggfvwdwvdq
slikydengnpwsayggdfgdtpndrqfcmnglvfadrtphpalteakhqqq

SCOPe Domain Coordinates for d1px4d5:

Click to download the PDB-style file with coordinates for d1px4d5.
(The format of our PDB-style files is described here.)

Timeline for d1px4d5: