Class b: All beta proteins [48724] (180 folds) |
Fold b.30: Supersandwich [49993] (3 superfamilies) sandwich; 18 strands in 2 sheets |
Superfamily b.30.5: Galactose mutarotase-like [74650] (12 families) probable carbohydrate-binding domain in enzymes acting on sugars |
Family b.30.5.1: beta-Galactosidase, domain 5 [49995] (1 protein) automatically mapped to Pfam PF02929 |
Protein beta-Galactosidase, domain 5 [49996] (2 species) |
Species Escherichia coli [TaxId:562] [49997] (46 PDB entries) Uniprot P00722 |
Domain d1px4b4: 1px4 B:731-1023 [104369] Other proteins in same PDB: d1px4a1, d1px4a2, d1px4a3, d1px4a5, d1px4b1, d1px4b2, d1px4b3, d1px4b5, d1px4c1, d1px4c2, d1px4c3, d1px4c5, d1px4d1, d1px4d2, d1px4d3, d1px4d5 complexed with dms, ipt, mg, na |
PDB Entry: 1px4 (more details), 1.6 Å
SCOPe Domain Sequences for d1px4b4:
Sequence; same for both SEQRES and ATOM records: (download)
>d1px4b4 b.30.5.1 (B:731-1023) beta-Galactosidase, domain 5 {Escherichia coli [TaxId: 562]} paashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltplrdqftrapld ndiavseatridpnawverwkaaghyqaeaallqctadtladavlittahawqhqgktlf isrktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlglgpqenypdrl taacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnisrysqqqlmet shrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvwcqk
Timeline for d1px4b4:
View in 3D Domains from same chain: (mouse over for more information) d1px4b1, d1px4b2, d1px4b3, d1px4b5 |