SCOPe 2.08: Domain d1pl5s_: 1pl5 S:

Lineage for d1pl5s_ (1pl5 S:)

1. Root: SCOPe 2.08

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.1: Parallel coiled-coil [57943] (41 superfamilies)
   this is not a true fold; includes oligomers of shorter identical helices

4. Superfamily h.1.23: Dimerization motif of sir4 [90242] (1 family)

5. Family h.1.23.1: Dimerization motif of sir4 [90243] (1 protein)

6. Protein Dimerization motif of sir4 [90244] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [90245] (2 PDB entries)
   Uniprot P11978 1272-1346

8. Domain d1pl5s_: 1pl5 S: [104187]
   protein/DNA complex

Details for d1pl5s_

PDB Entry: 1pl5, 2.5 Å

PDB Description: Crystal Structure Analysis of the Sir4p C-terminal Coiled Coil

PDB Compounds: (S:) Regulatory protein SIR4

SCOPe Domain Sequences for d1pl5s_:

Sequence; same for both SEQRES and ATOM records:

>d1pl5s_ h.1.23.1 (S:) Dimerization motif of sir4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
sfvdivlskaasaldekekqlavaneiirslsdevmrneiritslqgdltftkkclenar
sqisekdakinklmek

Timeline for d1pl5s_:

• d1pl5s_ first appeared in SCOP 1.69
  
• d1pl5s_ appears in SCOPe 2.07