Class h: Coiled coil proteins [57942] (6 folds) |
Fold h.1: Parallel coiled-coil [57943] (28 superfamilies) this is not a true fold; includes oligomers of shorter identical helices |
Superfamily h.1.23: Dimerization motif of sir4 [90242] (1 family) |
Family h.1.23.1: Dimerization motif of sir4 [90243] (1 protein) |
Protein Dimerization motif of sir4 [90244] (1 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [90245] (2 PDB entries) |
Domain d1pl5s_: 1pl5 S: [104187] |
PDB Entry: 1pl5 (more details), 2.5 Å
SCOP Domain Sequences for d1pl5s_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pl5s_ h.1.23.1 (S:) Dimerization motif of sir4 {Baker's yeast (Saccharomyces cerevisiae)} sfvdivlskaasaldekekqlavaneiirslsdevmrneiritslqgdltftkkclenar sqisekdakinklmek
Timeline for d1pl5s_: