SCOP 1.69: Domain d1pl5s_: 1pl5 S:

Lineage for d1pl5s_ (1pl5 S:)

1. Root: SCOP 1.69

2. Class h: Coiled coil proteins [57942] (6 folds)

3. Fold h.1: Parallel coiled-coil [57943] (28 superfamilies)
   this is not a true fold; includes oligomers of shorter identical helices

4. Superfamily h.1.23: Dimerization motif of sir4 [90242] (1 family)

5. Family h.1.23.1: Dimerization motif of sir4 [90243] (1 protein)

6. Protein Dimerization motif of sir4 [90244] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [90245] (2 PDB entries)

8. Domain d1pl5s_: 1pl5 S: [104187]

Details for d1pl5s_

PDB Entry: 1pl5, 2.5 Å

PDB Description: Crystal Structure Analysis of the Sir4p C-terminal Coiled Coil

SCOP Domain Sequences for d1pl5s_:

Sequence; same for both SEQRES and ATOM records:

>d1pl5s_ h.1.23.1 (S:) Dimerization motif of sir4 {Baker's yeast (Saccharomyces cerevisiae)}
sfvdivlskaasaldekekqlavaneiirslsdevmrneiritslqgdltftkkclenar
sqisekdakinklmek

Timeline for d1pl5s_:

• d1pl5s_ is new in SCOP 1.69
  
• d1pl5s_ appears in SCOP 1.71
  
• d1pl5s_ appears in the current release, SCOPe 2.08