Lineage for d1pl5s_ (1pl5 S:)

  1. Root: SCOPe 2.07
  2. 2643820Class h: Coiled coil proteins [57942] (7 folds)
  3. 2643821Fold h.1: Parallel coiled-coil [57943] (41 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 2645072Superfamily h.1.23: Dimerization motif of sir4 [90242] (1 family) (S)
  5. 2645073Family h.1.23.1: Dimerization motif of sir4 [90243] (1 protein)
  6. 2645074Protein Dimerization motif of sir4 [90244] (1 species)
  7. 2645075Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [90245] (2 PDB entries)
    Uniprot P11978 1272-1346
  8. 2645077Domain d1pl5s_: 1pl5 S: [104187]
    protein/DNA complex

Details for d1pl5s_

PDB Entry: 1pl5 (more details), 2.5 Å

PDB Description: Crystal Structure Analysis of the Sir4p C-terminal Coiled Coil
PDB Compounds: (S:) Regulatory protein SIR4

SCOPe Domain Sequences for d1pl5s_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pl5s_ h.1.23.1 (S:) Dimerization motif of sir4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
sfvdivlskaasaldekekqlavaneiirslsdevmrneiritslqgdltftkkclenar
sqisekdakinklmek

SCOPe Domain Coordinates for d1pl5s_:

Click to download the PDB-style file with coordinates for d1pl5s_.
(The format of our PDB-style files is described here.)

Timeline for d1pl5s_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1pl5a_