Lineage for d1pb0b_ (1pb0 B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2097504Fold c.6: 7-stranded beta/alpha barrel [51988] (3 superfamilies)
    variant of beta/alpha barrel; parallel beta-sheet barrel, closed, n=7, S=8; strand order 1234567; some members may have fewer strands
  4. 2097749Superfamily c.6.3: PHP domain-like [89550] (3 families) (S)
  5. 2097750Family c.6.3.1: PHP domain [89551] (2 protein domains)
    putative phosphoesterase domain; contains trinuclear metal-binding site; some similarity to the metallohydrolases of TIM-barrel fold
  6. 2097759Protein Hypothetical protein YcdX [89552] (1 species)
  7. 2097760Species Escherichia coli [TaxId:562] [89553] (3 PDB entries)
    Uniprot P75914
  8. 2097763Domain d1pb0b_: 1pb0 B: [104100]
    Structural genomics target
    complexed with fmt, so4, zn

Details for d1pb0b_

PDB Entry: 1pb0 (more details), 1.95 Å

PDB Description: ycdx protein in autoinhibited state
PDB Compounds: (B:) Hypothetical protein ycdX

SCOPe Domain Sequences for d1pb0b_:

Sequence, based on SEQRES records: (download)

>d1pb0b_ c.6.3.1 (B:) Hypothetical protein YcdX {Escherichia coli [TaxId: 562]}
mypvdlhmhtvasthaystlsdyiaqakqkgiklfaitdhgpdmedaphhwhfinmriwp
rvvdgvgilrgieaniknvdgeidcsgkmfdsldliiagfhepvfaphdkatntqamiat
iasgnvhiishpgnpkyeidvkavaeaaakhqvaleinnssflhsrkgsedncrevaaav
rdaggwvalgsdshtaftmgefeeclkildavdfpperilnvsprrllnflesrgmapia
efadl

Sequence, based on observed residues (ATOM records): (download)

>d1pb0b_ c.6.3.1 (B:) Hypothetical protein YcdX {Escherichia coli [TaxId: 562]}
mypvdlhmhtvasthaystlsdyiaqakqkgiklfaitdhgpdmedaphhwhfinmriwp
rvvdgvgilrgieaniknvdgeidcsgkmfdsldliiagfhepvfaphdkatntqamiat
iasgnvhiishpgnpkyeidvkavaeaaakhqvaleinflhncrevaaavrdaggwvalg
sdshtaftmgefeeclkildavdfpperilnvsprrllnflesrgmapiaefadl

SCOPe Domain Coordinates for d1pb0b_:

Click to download the PDB-style file with coordinates for d1pb0b_.
(The format of our PDB-style files is described here.)

Timeline for d1pb0b_: