Lineage for d1pb0a_ (1pb0 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2850482Fold c.6: 7-stranded beta/alpha barrel [51988] (3 superfamilies)
    variant of beta/alpha barrel; parallel beta-sheet barrel, closed, n=7, S=8; strand order 1234567; some members may have fewer strands
  4. 2850756Superfamily c.6.3: PHP domain-like [89550] (3 families) (S)
  5. 2850757Family c.6.3.1: PHP domain [89551] (2 proteins)
    putative phosphoesterase domain; contains trinuclear metal-binding site; some similarity to the metallohydrolases of TIM-barrel fold
  6. 2850766Protein Hypothetical protein YcdX [89552] (1 species)
  7. 2850767Species Escherichia coli [TaxId:562] [89553] (3 PDB entries)
    Uniprot P75914
  8. 2850769Domain d1pb0a_: 1pb0 A: [104099]
    Structural genomics target
    complexed with fmt, so4, zn

Details for d1pb0a_

PDB Entry: 1pb0 (more details), 1.95 Å

PDB Description: ycdx protein in autoinhibited state
PDB Compounds: (A:) Hypothetical protein ycdX

SCOPe Domain Sequences for d1pb0a_:

Sequence, based on SEQRES records: (download)

>d1pb0a_ c.6.3.1 (A:) Hypothetical protein YcdX {Escherichia coli [TaxId: 562]}
mypvdlhmhtvasthaystlsdyiaqakqkgiklfaitdhgpdmedaphhwhfinmriwp
rvvdgvgilrgieaniknvdgeidcsgkmfdsldliiagfhepvfaphdkatntqamiat
iasgnvhiishpgnpkyeidvkavaeaaakhqvaleinnssflhsrkgsedncrevaaav
rdaggwvalgsdshtaftmgefeeclkildavdfpperilnvsprrllnflesrgmapia
efadl

Sequence, based on observed residues (ATOM records): (download)

>d1pb0a_ c.6.3.1 (A:) Hypothetical protein YcdX {Escherichia coli [TaxId: 562]}
mypvdlhmhtvasthaystlsdyiaqakqkgiklfaitdhgpdmedaphhwhfinmriwp
rvvdgvgilrgieaniknvdgeidcsgkmfdsldliiagfhepvfaphdkatntqamiat
iasgnvhiishpgnpkyeidvkavaeaaakhqvaleinflhsncrevaaavrdaggwval
gsdshtaftmgefeeclkildavdfpperilnvsprrllnflesrgmapiaefadl

SCOPe Domain Coordinates for d1pb0a_:

Click to download the PDB-style file with coordinates for d1pb0a_.
(The format of our PDB-style files is described here.)

Timeline for d1pb0a_: