Lineage for d1pb0b_ (1pb0 B:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 479595Fold c.6: 7-stranded beta/alpha barrel [51988] (3 superfamilies)
    variant of beta/alpha barrel; parallel beta-sheet barrel, closed, n=7, S=8; strand order 1234567; some members may have fewer strands
  4. 479662Superfamily c.6.3: PHP domain-like [89550] (2 families) (S)
  5. 479663Family c.6.3.1: PHP domain [89551] (1 protein)
    putative phosphoesterase domain; contains trinuclear metal-binding site; some similarity to the metallohydrolases of TIM-barrel fold
  6. 479664Protein Hypothetical protein YcdX [89552] (1 species)
  7. 479665Species Escherichia coli [TaxId:562] [89553] (3 PDB entries)
  8. 479668Domain d1pb0b_: 1pb0 B: [104100]

Details for d1pb0b_

PDB Entry: 1pb0 (more details), 1.95 Å

PDB Description: ycdx protein in autoinhibited state

SCOP Domain Sequences for d1pb0b_:

Sequence, based on SEQRES records: (download)

>d1pb0b_ c.6.3.1 (B:) Hypothetical protein YcdX {Escherichia coli}
mypvdlhmhtvasthaystlsdyiaqakqkgiklfaitdhgpdmedaphhwhfinmriwp
rvvdgvgilrgieaniknvdgeidcsgkmfdsldliiagfhepvfaphdkatntqamiat
iasgnvhiishpgnpkyeidvkavaeaaakhqvaleinnssflhsrkgsedncrevaaav
rdaggwvalgsdshtaftmgefeeclkildavdfpperilnvsprrllnflesrgmapia
efadl

Sequence, based on observed residues (ATOM records): (download)

>d1pb0b_ c.6.3.1 (B:) Hypothetical protein YcdX {Escherichia coli}
mypvdlhmhtvasthaystlsdyiaqakqkgiklfaitdhgpdmedaphhwhfinmriwp
rvvdgvgilrgieaniknvdgeidcsgkmfdsldliiagfhepvfaphdkatntqamiat
iasgnvhiishpgnpkyeidvkavaeaaakhqvaleinflhncrevaaavrdaggwvalg
sdshtaftmgefeeclkildavdfpperilnvsprrllnflesrgmapiaefadl

SCOP Domain Coordinates for d1pb0b_:

Click to download the PDB-style file with coordinates for d1pb0b_.
(The format of our PDB-style files is described here.)

Timeline for d1pb0b_: