PDB entry 1pb0

View 1pb0 on RCSB PDB site
Description: ycdx protein in autoinhibited state
Class: structural genomics, unknown function
Keywords: structural genomics, beta-alpha-barrel, trinuclear zinc, autoinhibition, UNKNOWN FUNCTION
Deposited on 2003-05-14, released 2004-05-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.164
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical protein ycdX
    Species: Escherichia coli [TaxId:562]
    Gene: YCDX
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1pb0a_
  • Chain 'B':
    Compound: Hypothetical protein ycdX
    Species: Escherichia coli [TaxId:562]
    Gene: YCDX
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1pb0b_
  • Chain 'C':
    Compound: Hypothetical protein ycdX
    Species: Escherichia coli [TaxId:562]
    Gene: YCDX
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1pb0c_
  • Heterogens: ZN, SO4, FMT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1pb0A (A:)
    mypvdlhmhtvasthaystlsdyiaqakqkgiklfaitdhgpdmedaphhwhfinmriwp
    rvvdgvgilrgieaniknvdgeidcsgkmfdsldliiagfhepvfaphdkatntqamiat
    iasgnvhiishpgnpkyeidvkavaeaaakhqvaleinnssflhsrkgsedncrevaaav
    rdaggwvalgsdshtaftmgefeeclkildavdfpperilnvsprrllnflesrgmapia
    efadl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pb0A (A:)
    mypvdlhmhtvasthaystlsdyiaqakqkgiklfaitdhgpdmedaphhwhfinmriwp
    rvvdgvgilrgieaniknvdgeidcsgkmfdsldliiagfhepvfaphdkatntqamiat
    iasgnvhiishpgnpkyeidvkavaeaaakhqvaleinflhsncrevaaavrdaggwval
    gsdshtaftmgefeeclkildavdfpperilnvsprrllnflesrgmapiaefadl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1pb0B (B:)
    mypvdlhmhtvasthaystlsdyiaqakqkgiklfaitdhgpdmedaphhwhfinmriwp
    rvvdgvgilrgieaniknvdgeidcsgkmfdsldliiagfhepvfaphdkatntqamiat
    iasgnvhiishpgnpkyeidvkavaeaaakhqvaleinnssflhsrkgsedncrevaaav
    rdaggwvalgsdshtaftmgefeeclkildavdfpperilnvsprrllnflesrgmapia
    efadl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pb0B (B:)
    mypvdlhmhtvasthaystlsdyiaqakqkgiklfaitdhgpdmedaphhwhfinmriwp
    rvvdgvgilrgieaniknvdgeidcsgkmfdsldliiagfhepvfaphdkatntqamiat
    iasgnvhiishpgnpkyeidvkavaeaaakhqvaleinflhncrevaaavrdaggwvalg
    sdshtaftmgefeeclkildavdfpperilnvsprrllnflesrgmapiaefadl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1pb0C (C:)
    mypvdlhmhtvasthaystlsdyiaqakqkgiklfaitdhgpdmedaphhwhfinmriwp
    rvvdgvgilrgieaniknvdgeidcsgkmfdsldliiagfhepvfaphdkatntqamiat
    iasgnvhiishpgnpkyeidvkavaeaaakhqvaleinnssflhsrkgsedncrevaaav
    rdaggwvalgsdshtaftmgefeeclkildavdfpperilnvsprrllnflesrgmapia
    efadl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1pb0C (C:)
    mypvdlhmhtvasthaystlsdyiaqakqkgiklfaitdhgpdmedaphhwhfinmriwp
    rvvdgvgilrgieaniknvdgeidcsgkmfdsldliiagfhepvfaphdkatntqamiat
    iasgnvhiishpgnpkyeidvkavaeaaakhqvaleinflhncrevaaavrdaggwvalg
    sdshtaftmgefeeclkildavdfpperilnvsprrllnflesrgmapiaefadl