SCOPe 2.08: Domain d1owbb_: 1owb B:

Lineage for d1owbb_ (1owb B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.103: Citrate synthase [48255] (1 superfamily)
   multihelical; consists of two all-alpha domains

4. Superfamily a.103.1: Citrate synthase [48256] (2 families)

5. Family a.103.1.1: Citrate synthase [48257] (2 proteins)
   duplication: large domain consists of two structural repeats
   the second repeat is interrupted by the small domain
   automatically mapped to Pfam PF00285

6. Protein Citrate synthase [48258] (7 species)

7. Species Escherichia coli [TaxId:562] [81862] (12 PDB entries)
   Uniprot P00891

8. Domain d1owbb_: 1owb B: [104038]
   complexed with nad, so4

Details for d1owbb_

PDB Entry: 1owb, 2.2 Å

PDB Description: three dimensional structure analysis of the variant r109l nadh complex of type ii citrate synthase from e. coli

PDB Compounds: (B:) citrate synthase

SCOPe Domain Sequences for d1owbb_:

Sequence; same for both SEQRES and ATOM records:

>d1owbb_ a.103.1.1 (B:) Citrate synthase {Escherichia coli [TaxId: 562]}
adtkakltlngdtaveldvlkgtlgqdvidirtlgskgvftfdpgftstasceskitfid
gdegillhrgfpidqlatdsnylevcyillngekptqeqydefkttvtlhtmiheqitrl
fhafrrdshpmavmcgitgalaafyhdsldvnnprhreiaafrllskmptmaamcykysi
gqpfvyprndlsyagnflnmmfstpcepyevnpileramdrililhadheqnaststvrt
agssganpfaciaagiaslwgpahgganeaalkmleeissvkhipeffrrakdkndsfrl
mgfghrvyknydpratvmretchevlkelgtkddllevamelenialndpyfiekklypn
vdfysgiilkamgipssmftvifamartvgwiahwsemhsdgmkiarprqlytgyekrdf
ksdikr

Timeline for d1owbb_:

• d1owbb_ first appeared in SCOP 1.69
  
• d1owbb_ appears in SCOPe 2.07