Lineage for d1owba_ (1owb A:)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.103: Citrate synthase [48255] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. Superfamily a.103.1: Citrate synthase [48256] (2 families) (S)
  5. Family a.103.1.1: Citrate synthase [48257] (2 proteins)
    duplication: large domain consists of two structural repeats
    the second repeat is interrupted by the small domain
    automatically mapped to Pfam PF00285
  6. Protein Citrate synthase [48258] (7 species)
  7. Species Escherichia coli [TaxId:562] [81862] (12 PDB entries)
    Uniprot P00891
  8. Domain d1owba_: 1owb A: [104037]
    complexed with nad, so4

Details for d1owba_

PDB Entry: 1owb (more details), 2.2 Å

PDB Description: Three Dimensional Structure Analysis Of The Variant R109L NADH Complex of Type II Citrate Synthase From E. Coli
PDB Compounds: (A:) citrate synthase

SCOPe Domain Sequences for d1owba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1owba_ a.103.1.1 (A:) Citrate synthase {Escherichia coli [TaxId: 562]}
adtkakltlngdtaveldvlkgtlgqdvidirtlgskgvftfdpgftstasceskitfid
gdegillhrgfpidqlatdsnylevcyillngekptqeqydefkttvtlhtmiheqitrl
fhafrrdshpmavmcgitgalaafyhdsldvnnprhreiaafrllskmptmaamcykysi
gqpfvyprndlsyagnflnmmfstpcepyevnpileramdrililhadheqnaststvrt
agssganpfaciaagiaslwgpahgganeaalkmleeissvkhipeffrrakdkndsfrl
mgfghrvyknydpratvmretchevlkelgtkddllevamelenialndpyfiekklypn
vdfysgiilkamgipssmftvifamartvgwiahwsemhsdgmkiarprqlytgyekrdf
ksdikr

SCOPe Domain Coordinates for d1owba_ are not available.

Timeline for d1owba_:

Domains from other chains:
(mouse over for more information)
d1owbb_