Lineage for d1owbb_ (1owb B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2336030Fold a.103: Citrate synthase [48255] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2336031Superfamily a.103.1: Citrate synthase [48256] (2 families) (S)
  5. 2336032Family a.103.1.1: Citrate synthase [48257] (2 proteins)
    duplication: large domain consists of two structural repeats
    the second repeat is interrupted by the small domain
    automatically mapped to Pfam PF00285
  6. 2336033Protein Citrate synthase [48258] (7 species)
  7. 2336053Species Escherichia coli [TaxId:562] [81862] (12 PDB entries)
    Uniprot P00891
  8. 2336057Domain d1owbb_: 1owb B: [104038]
    complexed with nad, so4

Details for d1owbb_

PDB Entry: 1owb (more details), 2.2 Å

PDB Description: three dimensional structure analysis of the variant r109l nadh complex of type ii citrate synthase from e. coli
PDB Compounds: (B:) citrate synthase

SCOPe Domain Sequences for d1owbb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1owbb_ a.103.1.1 (B:) Citrate synthase {Escherichia coli [TaxId: 562]}
adtkakltlngdtaveldvlkgtlgqdvidirtlgskgvftfdpgftstasceskitfid
gdegillhrgfpidqlatdsnylevcyillngekptqeqydefkttvtlhtmiheqitrl
fhafrrdshpmavmcgitgalaafyhdsldvnnprhreiaafrllskmptmaamcykysi
gqpfvyprndlsyagnflnmmfstpcepyevnpileramdrililhadheqnaststvrt
agssganpfaciaagiaslwgpahgganeaalkmleeissvkhipeffrrakdkndsfrl
mgfghrvyknydpratvmretchevlkelgtkddllevamelenialndpyfiekklypn
vdfysgiilkamgipssmftvifamartvgwiahwsemhsdgmkiarprqlytgyekrdf
ksdikr

SCOPe Domain Coordinates for d1owbb_:

Click to download the PDB-style file with coordinates for d1owbb_.
(The format of our PDB-style files is described here.)

Timeline for d1owbb_: