Lineage for d1olma1 (1olm A:1-75)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1984734Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies)
    3 helices; bundle, right-handed twist
  4. 1984948Superfamily a.5.3: CRAL/TRIO N-terminal domain [46938] (2 families) (S)
  5. 1984949Family a.5.3.1: CRAL/TRIO N-terminal domain [46939] (3 protein domains)
  6. 1984959Protein Supernatant protein factor (SPF), N-terminal domain [101071] (1 species)
    Sec14-like protein 2; contains extra C-terminal beta-sandwich domain
  7. 1984960Species Human (Homo sapiens) [TaxId:9606] [101072] (2 PDB entries)
    Uniprot O76054
  8. 1984961Domain d1olma1: 1olm A:1-75 [104008]
    Other proteins in same PDB: d1olma2, d1olma3, d1olmc2, d1olmc3, d1olme2, d1olme3
    complexed with vtq

Details for d1olma1

PDB Entry: 1olm (more details), 1.95 Å

PDB Description: supernatant protein factor in complex with rrr-alpha-tocopherylquinone: a link between oxidized vitamin e and cholesterol biosynthesis
PDB Compounds: (A:) sec14-like protein 2

SCOPe Domain Sequences for d1olma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1olma1 a.5.3.1 (A:1-75) Supernatant protein factor (SPF), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
msgrvgdlsprqkealakfrenvqdvlpalpnpddyfllrwlrarsfdlqkseamlrkhv
efrkqkdidniiswq

SCOPe Domain Coordinates for d1olma1:

Click to download the PDB-style file with coordinates for d1olma1.
(The format of our PDB-style files is described here.)

Timeline for d1olma1: