![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.132: Supernatant protein factor (SPF), C-terminal domain [101575] (1 superfamily) sandwich; 8 strands in 2 sheets; jelly-roll; similarity to the Nucleoplasmin-like/VP fold |
![]() | Superfamily b.132.1: Supernatant protein factor (SPF), C-terminal domain [101576] (2 families) ![]() |
![]() | Family b.132.1.1: Supernatant protein factor (SPF), C-terminal domain [101577] (1 protein) |
![]() | Protein Supernatant protein factor (SPF), C-terminal domain [101578] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [101579] (2 PDB entries) Uniprot O76054 |
![]() | Domain d1olme2: 1olm E:275-393 [104015] Other proteins in same PDB: d1olma1, d1olma3, d1olmc1, d1olmc3, d1olme1, d1olme3 complexed with vtq |
PDB Entry: 1olm (more details), 1.95 Å
SCOPe Domain Sequences for d1olme2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1olme2 b.132.1.1 (E:275-393) Supernatant protein factor (SPF), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} kqqyehsvqisrgsshqveyeilfpgcvlrwqfmsdgadvgfgiflkkkmgerqragemt evlpnqrynshlvpedgtltcsdpgiyvlrfdntysfihakkvnftvevllpdkaseek
Timeline for d1olme2: