SCOP 1.69: Domain d1okja2: 1okj A:107-216

Lineage for d1okja2 (1okj A:107-216)

1. Root: SCOP 1.69

2. Class c: Alpha and beta proteins (a/b) [51349] (136 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (10 families)
   duplication contains two domains of this fold

5. Family c.55.1.9: YeaZ-like (Pfam 00814) [110633] (1 protein)
   ubiquitous cytoplasmic protein; annotated as Glycoprotease (Peptidase_M22 family) on the basis of one member's known activity outside the cell

6. Protein Hypothetical protein YeaZ [110634] (1 species)

7. Species Escherichia coli [TaxId:562] [110635] (1 PDB entry)

8. Domain d1okja2: 1okj A:107-216 [103999]

Details for d1okja2

PDB Entry: 1okj, 2.28 Å

PDB Description: crystal structure of the essential E. coli YeaZ protein by MAD method using the gadolinium complex "DOTMA"

SCOP Domain Sequences for d1okja2:

Sequence; same for both SEQRES and ATOM records:

>d1okja2 c.55.1.9 (A:107-216) Hypothetical protein YeaZ {Escherichia coli}
atrvlaaidarmgevywaeyqrdengiwhgeeteavlkpeivhermqqlsgewvtvgtgw
qawpdlgkesglvlrdgevllpaaedmlpiacqmfaegktvavehaepvy

Timeline for d1okja2:

• d1okja2 is new in SCOP 1.69
  
• d1okja2 appears in SCOP 1.71
  
• d1okja2 appears in the current release, SCOPe 2.08