Lineage for d1okjb2 (1okj B:107-216)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 488062Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 488063Superfamily c.55.1: Actin-like ATPase domain [53067] (10 families) (S)
    duplication contains two domains of this fold
  5. 488372Family c.55.1.9: YeaZ-like (Pfam 00814) [110633] (1 protein)
    ubiquitous cytoplasmic protein; annotated as Glycoprotease (Peptidase_M22 family) on the basis of one member's known activity outside the cell
  6. 488373Protein Hypothetical protein YeaZ [110634] (1 species)
  7. 488374Species Escherichia coli [TaxId:562] [110635] (1 PDB entry)
  8. 488378Domain d1okjb2: 1okj B:107-216 [104001]

Details for d1okjb2

PDB Entry: 1okj (more details), 2.28 Å

PDB Description: crystal structure of the essential E. coli YeaZ protein by MAD method using the gadolinium complex "DOTMA"

SCOP Domain Sequences for d1okjb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1okjb2 c.55.1.9 (B:107-216) Hypothetical protein YeaZ {Escherichia coli}
atrvlaaidarmgevywaeyqrdengiwhgeeteavlkpeivhermqqlsgewvtvgtgw
qawpdlgkesglvlrdgevllpaaedmlpiacqmfaegktvavehaepvy

SCOP Domain Coordinates for d1okjb2:

Click to download the PDB-style file with coordinates for d1okjb2.
(The format of our PDB-style files is described here.)

Timeline for d1okjb2: