![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
![]() | Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) ![]() duplication contains two domains of this fold |
![]() | Family c.55.1.9: YeaZ-like [110633] (3 proteins) Pfam PF00814; ubiquitous cytoplasmic protein; annotated as Glycoprotease (Peptidase_M22 family) on the basis of one member's known extracellular activity |
![]() | Protein Hypothetical protein YeaZ [110634] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [110635] (1 PDB entry) Uniprot P76256 |
![]() | Domain d1okja2: 1okj A:107-216 [103999] Other proteins in same PDB: d1okja3, d1okjb3, d1okjc3, d1okjd3 complexed with gd3 |
PDB Entry: 1okj (more details), 2.28 Å
SCOPe Domain Sequences for d1okja2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1okja2 c.55.1.9 (A:107-216) Hypothetical protein YeaZ {Escherichia coli [TaxId: 562]} atrvlaaidarmgevywaeyqrdengiwhgeeteavlkpeivhermqqlsgewvtvgtgw qawpdlgkesglvlrdgevllpaaedmlpiacqmfaegktvavehaepvy
Timeline for d1okja2: