PDB entry 1okj

View 1okj on RCSB PDB site
Description: crystal structure of the essential E. coli YeaZ protein by MAD method using the gadolinium complex "DOTMA"
Class: hydrolase
Keywords: potential zinc protease, hypothetical protease yeaz, metalloprotease, hydrolase, bacterial targets at igs-cnrs, france, bigs, structural genomics
Deposited on 2003-07-26, released 2004-09-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-07-23, with a file datestamp of 2014-07-18.
Experiment type: XRAY
Resolution: 2.28 Å
R-factor: 0.216
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tRNA threonylcarbamoyladenosine biosynthesis protein tsab
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed):
    • PDB 1OKJ (Start-20)
    • Uniprot P76256 (21-End)
    Domains in SCOPe 2.07: d1okja1, d1okja2, d1okja3
  • Chain 'B':
    Compound: tRNA threonylcarbamoyladenosine biosynthesis protein tsab
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed):
    • PDB 1OKJ (Start-20)
    • Uniprot P76256 (21-End)
    Domains in SCOPe 2.07: d1okjb1, d1okjb2, d1okjb3
  • Chain 'C':
    Compound: tRNA threonylcarbamoyladenosine biosynthesis protein tsab
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed):
    • PDB 1OKJ (Start-20)
    • Uniprot P76256 (21-End)
    Domains in SCOPe 2.07: d1okjc1, d1okjc2, d1okjc3
  • Chain 'D':
    Compound: tRNA threonylcarbamoyladenosine biosynthesis protein tsab
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed):
    • PDB 1OKJ (Start-20)
    • Uniprot P76256 (21-End)
    Domains in SCOPe 2.07: d1okjd1, d1okjd2, d1okjd3
  • Heterogens: GD3, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1okjA (A:)
    syyhhhhhhlestslykkaglrilaidtateacsvalwndgtvnahfelcprehtqrilp
    mvqdilttsgtsltdinalaygrgpgsftgvrigigiaqglalgaelpmigvstlmtmaq
    gawrkngatrvlaaidarmgevywaeyqrdengiwhgeeteavlkpeivhermqqlsgew
    vtvgtgwqawpdlgkesglvlrdgevllpaaedmlpiacqmfaegktvavehaepvylrn
    nvawkklpgke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1okjA (A:)
    glrilaidtateacsvalwndgtvnahfelcprehtqrilpmvqdilttsgtsltdinal
    aygrgpgsftgvrigigiaqglalgaelpmigvstlmtmaqgawrkngatrvlaaidarm
    gevywaeyqrdengiwhgeeteavlkpeivhermqqlsgewvtvgtgwqawpdlgkesgl
    vlrdgevllpaaedmlpiacqmfaegktvavehaepvylr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1okjB (B:)
    syyhhhhhhlestslykkaglrilaidtateacsvalwndgtvnahfelcprehtqrilp
    mvqdilttsgtsltdinalaygrgpgsftgvrigigiaqglalgaelpmigvstlmtmaq
    gawrkngatrvlaaidarmgevywaeyqrdengiwhgeeteavlkpeivhermqqlsgew
    vtvgtgwqawpdlgkesglvlrdgevllpaaedmlpiacqmfaegktvavehaepvylrn
    nvawkklpgke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1okjB (B:)
    kkaglrilaidtateacsvalwndgtvnahfelcprehtqrilpmvqdilttsgtsltdi
    nalaygrgpgsftgvrigigiaqglalgaelpmigvstlmtmaqgawrkngatrvlaaid
    armgevywaeyqrdengiwhgeeteavlkpeivhermqqlsgewvtvgtgwqawpdlgke
    sglvlrdgevllpaaedmlpiacqmfaegktvavehaepvylr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1okjC (C:)
    syyhhhhhhlestslykkaglrilaidtateacsvalwndgtvnahfelcprehtqrilp
    mvqdilttsgtsltdinalaygrgpgsftgvrigigiaqglalgaelpmigvstlmtmaq
    gawrkngatrvlaaidarmgevywaeyqrdengiwhgeeteavlkpeivhermqqlsgew
    vtvgtgwqawpdlgkesglvlrdgevllpaaedmlpiacqmfaegktvavehaepvylrn
    nvawkklpgke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1okjC (C:)
    glrilaidtateacsvalwndgtvnahfelcprehtqrilpmvqdilttsgtsltdinal
    aygrgpgsftgvrigigiaqglalgaelpmigvstlmtmaqgawrkngatrvlaaidarm
    gevywaeyqrdengiwhgeeteavlkpeivhermqqlsgewvtvgtgwqawpdlgkesgl
    vlrdgevllpaaedmlpiacqmfaegktvavehaepvyl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1okjD (D:)
    syyhhhhhhlestslykkaglrilaidtateacsvalwndgtvnahfelcprehtqrilp
    mvqdilttsgtsltdinalaygrgpgsftgvrigigiaqglalgaelpmigvstlmtmaq
    gawrkngatrvlaaidarmgevywaeyqrdengiwhgeeteavlkpeivhermqqlsgew
    vtvgtgwqawpdlgkesglvlrdgevllpaaedmlpiacqmfaegktvavehaepvylrn
    nvawkklpgke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1okjD (D:)
    aglrilaidtateacsvalwndgtvnahfelcprehtqrilpmvqdilttsgtsltdina
    laygrgpgsftgvrigigiaqglalgaelpmigvstlmtmaqgawrkngatrvlaaidar
    mgevywaeyqrdengiwhgeeteavlkpeivhermqqlsgewvtvgtgwqawpdlgkesg
    lvlrdgevllpaaedmlpiacqmfaegktvavehaepvylr