Class c: Alpha and beta proteins (a/b) [51349] (136 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (10 families) duplication contains two domains of this fold |
Family c.55.1.9: YeaZ-like (Pfam 00814) [110633] (1 protein) ubiquitous cytoplasmic protein; annotated as Glycoprotease (Peptidase_M22 family) on the basis of one member's known activity outside the cell |
Protein Hypothetical protein YeaZ [110634] (1 species) |
Species Escherichia coli [TaxId:562] [110635] (1 PDB entry) |
Domain d1okja1: 1okj A:1-106 [103998] |
PDB Entry: 1okj (more details), 2.28 Å
SCOP Domain Sequences for d1okja1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1okja1 c.55.1.9 (A:1-106) Hypothetical protein YeaZ {Escherichia coli} rilaidtateacsvalwndgtvnahfelcprehtqrilpmvqdilttsgtsltdinalay grgpgsftgvrigigiaqglalgaelpmigvstlmtmaqgawrkng
Timeline for d1okja1: