SCOPe 2.08: Domain d1oiyb1: 1oiy B:175-309

Lineage for d1oiyb1 (1oiy B:175-309)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.74: Cyclin-like [47953] (1 superfamily)
   core: 5 helices; one helix is surrounded by the others

4. Superfamily a.74.1: Cyclin-like [47954] (4 families)
   duplication: consists of two domains of this fold

5. Family a.74.1.1: Cyclin [47955] (9 proteins)

6. Protein Cyclin A [47956] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47957] (89 PDB entries)
   Uniprot P20248 175-432

8. Domain d1oiyb1: 1oiy B:175-309 [103965]
   Other proteins in same PDB: d1oiya1, d1oiya2, d1oiyc1, d1oiyc2
   complexed with mg, n41, sgm

Details for d1oiyb1

PDB Entry: 1oiy, 2.4 Å

PDB Description: structure of human thr160-phospho cdk2/cyclin a complexed with a 6-cyclohexylmethyloxy-2-anilino-purine inhibitor

PDB Compounds: (B:) cyclin a2

SCOPe Domain Sequences for d1oiyb1:

Sequence; same for both SEQRES and ATOM records:

>d1oiyb1 a.74.1.1 (B:175-309) Cyclin A {Human (Homo sapiens) [TaxId: 9606]}
vpdyhedihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeeyklqnetlhl
avnyidrflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyitddtytkkqvlrm
ehlvlkvltfdlaap

Timeline for d1oiyb1:

• d1oiyb1 first appeared in SCOP 1.69
  
• d1oiyb1 appears in SCOPe 2.07