Lineage for d1oiyb1 (1oiy B:175-309)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 445218Fold a.74: Cyclin-like [47953] (1 superfamily)
    core: 5 helices; one helix is surrounded by the others
  4. 445219Superfamily a.74.1: Cyclin-like [47954] (3 families) (S)
    duplication: consists of two domains of this fold
  5. 445220Family a.74.1.1: Cyclin [47955] (4 proteins)
  6. 445225Protein Cyclin A [47956] (2 species)
  7. 445229Species Human (Homo sapiens) [TaxId:9606] [47957] (28 PDB entries)
  8. 445300Domain d1oiyb1: 1oiy B:175-309 [103965]
    Other proteins in same PDB: d1oiya_, d1oiyc_

Details for d1oiyb1

PDB Entry: 1oiy (more details), 2.4 Å

PDB Description: structure of human thr160-phospho cdk2/cyclin a complexed with a 6-cyclohexylmethyloxy-2-anilino-purine inhibitor

SCOP Domain Sequences for d1oiyb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oiyb1 a.74.1.1 (B:175-309) Cyclin A {Human (Homo sapiens)}
vpdyhedihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeeyklqnetlhl
avnyidrflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyitddtytkkqvlrm
ehlvlkvltfdlaap

SCOP Domain Coordinates for d1oiyb1:

Click to download the PDB-style file with coordinates for d1oiyb1.
(The format of our PDB-style files is described here.)

Timeline for d1oiyb1: