Lineage for d1oiyd1 (1oiy D:175-309)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.74: Cyclin-like [47953] (1 superfamily)
    core: 5 helices; one helix is surrounded by the others
  4. Superfamily a.74.1: Cyclin-like [47954] (4 families) (S)
    duplication: consists of two domains of this fold
  5. Family a.74.1.1: Cyclin [47955] (9 proteins)
  6. Protein Cyclin A [47956] (2 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [47957] (88 PDB entries)
    Uniprot P20248 175-432
  8. Domain d1oiyd1: 1oiy D:175-309 [103968]
    Other proteins in same PDB: d1oiya1, d1oiya2, d1oiyc1, d1oiyc2
    complexed with mg, n41, sgm

Details for d1oiyd1

PDB Entry: 1oiy (more details), 2.4 Å

PDB Description: structure of human thr160-phospho cdk2/cyclin a complexed with a 6-cyclohexylmethyloxy-2-anilino-purine inhibitor
PDB Compounds: (D:) cyclin a2

SCOPe Domain Sequences for d1oiyd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oiyd1 a.74.1.1 (D:175-309) Cyclin A {Human (Homo sapiens) [TaxId: 9606]}
vpdyhedihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeeyklqnetlhl
avnyidrflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyitddtytkkqvlrm
ehlvlkvltfdlaap

SCOPe Domain Coordinates for d1oiyd1 are not available.

Timeline for d1oiyd1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1oiyd2
View in 3D
Domains from other chains:
(mouse over for more information)
d1oiya1, d1oiya2, d1oiyb1, d1oiyb2, d1oiyc1, d1oiyc2