SCOPe 2.08: Domain d1oi9b2: 1oi9 B:310-432

Lineage for d1oi9b2 (1oi9 B:310-432)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.74: Cyclin-like [47953] (1 superfamily)
   core: 5 helices; one helix is surrounded by the others

4. Superfamily a.74.1: Cyclin-like [47954] (4 families)
   duplication: consists of two domains of this fold

5. Family a.74.1.1: Cyclin [47955] (9 proteins)

6. Protein Cyclin A [47956] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47957] (89 PDB entries)
   Uniprot P20248 175-432

8. Domain d1oi9b2: 1oi9 B:310-432 [103948]
   Other proteins in same PDB: d1oi9a1, d1oi9a2, d1oi9c1, d1oi9c2
   complexed with mg, n20, sgm

Details for d1oi9b2

PDB Entry: 1oi9, 2.1 Å

PDB Description: structure of human thr160-phospho cdk2/cyclin a complexed with a 6-cyclohexylmethyloxy-2-anilino-purine inhibitor

PDB Compounds: (B:) cyclin a2

SCOPe Domain Sequences for d1oi9b2:

Sequence; same for both SEQRES and ATOM records:

>d1oi9b2 a.74.1.1 (B:310-432) Cyclin A {Human (Homo sapiens) [TaxId: 9606]}
tvnqfltqyflhqqpanckveslamflgelslidadpylkylpsviagaafhlalytvtg
qswpeslirktgytleslkpclmdlhqtylkapqhaqqsirekyknskyhgvsllnppet
lnl

Timeline for d1oi9b2:

• d1oi9b2 first appeared in SCOP 1.69
  
• d1oi9b2 appears in SCOPe 2.07